BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308H06f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC14C8.06 |arc1|sop2|ARP2/3 actin-organizing complex subunit S... 29 0.32 SPAC1687.12c |coq4||ubiquinone biosynthesis protein Coq4|Schizos... 25 5.2 SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccha... 25 6.8 >SPBC14C8.06 |arc1|sop2|ARP2/3 actin-organizing complex subunit Sop2|Schizosaccharomyces pombe|chr 2|||Manual Length = 377 Score = 29.5 bits (63), Expect = 0.32 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 383 NSQRSQCDTTSKTNTHQLYRQDKLRW 460 NSQR++ TT+ TN +LY QD W Sbjct: 20 NSQRTEFVTTTATNQVELYEQDGNGW 45 >SPAC1687.12c |coq4||ubiquinone biosynthesis protein Coq4|Schizosaccharomyces pombe|chr 1|||Manual Length = 272 Score = 25.4 bits (53), Expect = 5.2 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -2 Query: 409 CIALRSLRILYLYWNVRSGVSNLELHRYHWIKDV 308 C R +Y+ W++R+G++ L +W K++ Sbjct: 219 CEQASRFRRVYIPWSIRNGLNAKTLINVYWEKEL 252 >SPBC23E6.09 |ssn6||transcriptional corepressor Ssn6|Schizosaccharomyces pombe|chr 2|||Manual Length = 1102 Score = 25.0 bits (52), Expect = 6.8 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +2 Query: 356 APYVPIQIKNSQRSQCDTTSKTNTHQLYRQ 445 +PY+P+ ++ Q+SQ + HQ +Q Sbjct: 159 SPYIPVPLQQQQQSQPQQQPQQQQHQQPQQ 188 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,046,684 Number of Sequences: 5004 Number of extensions: 41186 Number of successful extensions: 88 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 88 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 88 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -