BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308H04f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 23 1.4 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 23 2.5 DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chlor... 22 3.3 DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chlor... 22 3.3 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 3.3 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 3.3 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 3.3 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 22 4.4 AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 21 5.8 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 21 5.8 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 23.4 bits (48), Expect = 1.4 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -3 Query: 210 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQTPQT 103 +DEAE S+ G + QS I +VAR+ +T T Sbjct: 272 SDEAEPSSTSKKSGIVRSHQQSCINRVARETKTAGT 307 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.6 bits (46), Expect = 2.5 Identities = 8/27 (29%), Positives = 15/27 (55%) Frame = -3 Query: 165 RHQYCQSWILQVARQRQTPQTTCHSKS 85 RH ++W+ R + TPQ+ S++ Sbjct: 241 RHLERKAWVASFGRPKMTPQSLLPSQT 267 >DQ667186-1|ABG75738.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 3.3 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 517 FILVNVASCRIRHEGNIE-PWPPQK 446 F LVN AS H NIE +PP + Sbjct: 322 FALVNYASRSDMHSDNIEKKYPPSE 346 >DQ667185-1|ABG75737.1| 447|Apis mellifera glutamate-gated chloride channel protein. Length = 447 Score = 22.2 bits (45), Expect = 3.3 Identities = 12/25 (48%), Positives = 14/25 (56%), Gaps = 1/25 (4%) Frame = -2 Query: 517 FILVNVASCRIRHEGNIE-PWPPQK 446 F LVN AS H NIE +PP + Sbjct: 322 FALVNYASRSDMHSDNIEKKYPPSE 346 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 210 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 115 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 210 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 115 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 210 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 115 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 210 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 115 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 210 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 115 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 210 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 115 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 210 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 115 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 3.3 Identities = 9/32 (28%), Positives = 20/32 (62%) Frame = -3 Query: 210 TDEAEVCICSRWQGPRHQYCQSWILQVARQRQ 115 ++++E + SR Q R + + W++Q R+R+ Sbjct: 20 SEDSETGLRSRTQEERLRRRREWMIQQERERE 51 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 21.8 bits (44), Expect = 4.4 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -1 Query: 218 VSEQTRLKYASAPDGKVPVI 159 V EQT A D KVP+I Sbjct: 230 VKEQTLQSIEMAKDAKVPII 249 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 225 DISL*TDEAEVCICSRWQGPRHQYCQ 148 D+S E + CI + Q R QYC+ Sbjct: 141 DLSYACREEKSCIIDKRQRNRCQYCR 166 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 21.4 bits (43), Expect = 5.8 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -3 Query: 225 DISL*TDEAEVCICSRWQGPRHQYCQ 148 D+S E + CI + Q R QYC+ Sbjct: 141 DLSYACREEKSCIIDKRQRNRCQYCR 166 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 136,971 Number of Sequences: 438 Number of extensions: 3031 Number of successful extensions: 16 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -