BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308H03f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. 24 0.82 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.5 AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein ... 21 5.8 DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein ... 21 7.7 AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific pro... 21 7.7 >U66709-1|AAB07515.1| 182|Apis mellifera ankyrin protein. Length = 182 Score = 24.2 bits (50), Expect = 0.82 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = -1 Query: 392 YNGLVPTIRPFISVTALVASSGEEKQTNPKPLLRPSSSITFADVI 258 Y G PT+R S+ + S E T PL + +++F + Sbjct: 70 YGGEQPTLRLLCSIAGGTSESQWEDVTGSTPLTFVNDTVSFTTTV 114 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -1 Query: 161 RSDFSCSNLRFNSF*RSAFFCARPT*RGLPSTSSLP 54 R+D S S+ +S + F+ +PT P S LP Sbjct: 368 RTDISSSSSSISSSEENDFWQPKPTLEDAPQNSLLP 403 >AJ973401-1|CAJ01448.1| 130|Apis mellifera hypothetical protein protein. Length = 130 Score = 21.4 bits (43), Expect = 5.8 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 31 ERACIELNGKELVEGKPLYVGRAQKKAERQKELKRKFEQ 147 +R I+ K LVE KP K + K+ + KFE+ Sbjct: 83 QREVIKKVIKFLVENKPELWDSLANKYDPDKKFRVKFEE 121 >DQ855484-1|ABH88171.1| 130|Apis mellifera chemosensory protein 3 protein. Length = 130 Score = 21.0 bits (42), Expect = 7.7 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 31 ERACIELNGKELVEGKPLYVGRAQKKAERQKELKRKFEQ 147 +R I+ K LVE KP K + K+ + KFE+ Sbjct: 83 QREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEE 121 >AF481963-1|AAN59784.1| 130|Apis mellifera antennal-specific protein 3c precursor protein. Length = 130 Score = 21.0 bits (42), Expect = 7.7 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 31 ERACIELNGKELVEGKPLYVGRAQKKAERQKELKRKFEQ 147 +R I+ K LVE KP K + K+ + KFE+ Sbjct: 83 QREVIKKVIKFLVENKPELWDSLANKYDPDKKYRVKFEE 121 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 125,057 Number of Sequences: 438 Number of extensions: 2596 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -