BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G11f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_21382| Best HMM Match : Ail_Lom (HMM E-Value=2.5) 29 2.3 SB_58462| Best HMM Match : Got1 (HMM E-Value=0.28) 27 7.1 SB_47023| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 SB_37834| Best HMM Match : TB (HMM E-Value=5.5) 27 7.1 SB_23702| Best HMM Match : F5_F8_type_C (HMM E-Value=3.7e-11) 27 7.1 >SB_21382| Best HMM Match : Ail_Lom (HMM E-Value=2.5) Length = 473 Score = 29.1 bits (62), Expect = 2.3 Identities = 19/55 (34%), Positives = 22/55 (40%) Frame = +1 Query: 154 VADSLTGDYKSQQEERNGDLVQGSYSLVEPDGTRRVVDYAADSINGFNAVVRKEP 318 V DS GDY + GD V+ S S G V YAA G A+ P Sbjct: 187 VCDSFQGDYARVSDSFQGDYVRVSDSFQSFQGDYARVRYAAAGFFGRQAIDDSRP 241 >SB_58462| Best HMM Match : Got1 (HMM E-Value=0.28) Length = 339 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/55 (21%), Positives = 28/55 (50%) Frame = -3 Query: 342 NCRRSRHEWLFTYYGIEAINGVSGVVHDTTCAVGFNQRVRSLNQISIAFFLLTFV 178 +C+ + +F ++G +NG+ V V + ++ ++ + +AFF L+ V Sbjct: 175 HCKLFKTAAVFAFFGSVVLNGIVPVSLLCAAVVTSSYKLLQMDYVPLAFFFLSLV 229 >SB_47023| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 34 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 121 DPLPQYRFGYDVADSLTGDYKSQQEERNG 207 D PQ+ Y+V SLTGD E+ NG Sbjct: 3 DDFPQWVTKYNVNYSLTGDQWQSYEDENG 31 >SB_37834| Best HMM Match : TB (HMM E-Value=5.5) Length = 131 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = -3 Query: 285 NGVSGVVHDTTCAVGFNQRVRSLNQISIAF 196 NGVS V D+ C + + VR++++ S+AF Sbjct: 53 NGVSENVLDSDCLIAASSFVRTVDKTSVAF 82 >SB_23702| Best HMM Match : F5_F8_type_C (HMM E-Value=3.7e-11) Length = 187 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = +1 Query: 121 DPLPQYRFGYDVADSLTGDYKSQQEERNG 207 D PQ+ Y+V SLTGD E+ NG Sbjct: 156 DDFPQWVTKYNVNYSLTGDQWQSYEDENG 184 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.137 0.394 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,057,575 Number of Sequences: 59808 Number of extensions: 175609 Number of successful extensions: 523 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 486 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 523 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -