BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G07f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_02_0094 - 5583932-5584036,5584137-5584200,5584305-5584387,558... 101 3e-22 03_06_0052 - 31295839-31295883,31296312-31296380,31296458-312965... 100 8e-22 03_06_0061 + 31352703-31353037,31353145-31353274,31353708-313539... 88 5e-18 07_01_0105 - 798883-798942,799118-799186,799282-799345,799434-79... 72 3e-13 08_02_0881 - 22216657-22216780,22216918-22217056,22217120-222171... 32 0.32 10_08_0365 + 17224777-17224852,17224949-17224989,17225175-172252... 29 1.7 01_05_0406 + 21875376-21875451,21875570-21875610,21876245-218763... 29 1.7 04_04_0503 - 25701050-25701343,25701431-25701528,25701629-257016... 29 2.3 01_01_0752 - 5808798-5810183 28 4.0 01_01_0691 - 5328169-5328228,5328300-5328488,5328611-5328768,532... 28 4.0 04_01_0105 + 1098551-1100392 28 5.2 01_05_0438 + 22142646-22143659,22144319-22144858 28 5.2 08_01_0469 - 4127950-4127988,4127989-4128264,4128845-4130861,413... 27 6.9 02_01_0457 - 3283759-3285240 27 6.9 05_02_0102 - 6616497-6616601,6616652-6617884 27 9.1 02_05_1170 + 34663853-34663928,34664038-34664078,34664317-346643... 27 9.1 >03_02_0094 - 5583932-5584036,5584137-5584200,5584305-5584387, 5584523-5584588,5584711-5584801,5585259-5585392, 5586219-5586413,5586886-5587015,5587873-5587958 Length = 317 Score = 101 bits (243), Expect = 3e-22 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = +2 Query: 296 SRARVYADVNSQRPREYWDYESYVVDWGNQEDYQLVRKLGRGKYSEVFEAINITNNE 466 S ARVYADVN RPREYWDYE+ V+WG Q+DY++VRK+GRGKYSEVFE IN+TN+E Sbjct: 2 STARVYADVNVHRPREYWDYEALAVEWGEQDDYEVVRKVGRGKYSEVFEGINVTNDE 58 >03_06_0052 - 31295839-31295883,31296312-31296380,31296458-31296521, 31296598-31296680,31297243-31297308,31297426-31297516, 31298090-31298247,31298432-31298476,31299189-31299318, 31300685-31300935 Length = 333 Score = 100 bits (239), Expect = 8e-22 Identities = 41/57 (71%), Positives = 49/57 (85%) Frame = +2 Query: 296 SRARVYADVNSQRPREYWDYESYVVDWGNQEDYQLVRKLGRGKYSEVFEAINITNNE 466 S+ARVYADVN RP+EYWDYE+ V WG Q+DY++VRK+GRGKYSEVFE IN+ NNE Sbjct: 57 SKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKVGRGKYSEVFEGINVNNNE 113 >03_06_0061 + 31352703-31353037,31353145-31353274,31353708-31353902, 31354696-31354725,31355238-31355395,31355756-31355846, 31355924-31355989,31356331-31356413,31356495-31356558, 31356641-31356709,31356798-31356833 Length = 418 Score = 87.8 bits (208), Expect = 5e-18 Identities = 37/57 (64%), Positives = 45/57 (78%) Frame = +2 Query: 296 SRARVYADVNSQRPREYWDYESYVVDWGNQEDYQLVRKLGRGKYSEVFEAINITNNE 466 S ARVYAD NSQRP+EYWDYES ++WG Q+ Y+++RKLGRGKYSEVFE +E Sbjct: 85 SVARVYADANSQRPKEYWDYESLDIEWGEQDGYEVLRKLGRGKYSEVFEGFRPGGDE 141 >07_01_0105 - 798883-798942,799118-799186,799282-799345,799434-799516, 799957-800022,800143-800233,800622-800779,801144-801338, 801499-801628,803016-803168,803877-803962 Length = 384 Score = 71.7 bits (168), Expect = 3e-13 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = +2 Query: 347 WDYESYVVDWGNQEDYQLVRKLGRGKYSEVFEAINITNNE 466 WDYE+ + WG Q+DY++VRK+GRGKYSEVFE IN+ NNE Sbjct: 70 WDYEALTIRWGEQDDYEVVRKVGRGKYSEVFEGINVNNNE 109 Score = 51.6 bits (118), Expect = 4e-07 Identities = 20/31 (64%), Positives = 24/31 (77%) Frame = +2 Query: 296 SRARVYADVNSQRPREYWDYESYVVDWGNQE 388 S+ARVY DVN RP+EYWDYE+ V WG Q+ Sbjct: 2 SKARVYTDVNVLRPKEYWDYEALTVQWGVQQ 32 >08_02_0881 - 22216657-22216780,22216918-22217056,22217120-22217192, 22218260-22218357,22218516-22218542,22218625-22218715, 22218819-22218900,22219983-22220098 Length = 249 Score = 31.9 bits (69), Expect = 0.32 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 392 YQLVRKLGRGKYSEVFEAINITNNE 466 ++ +RK+G G Y EVFEA++I E Sbjct: 27 FRRIRKIGEGTYGEVFEAMDIITGE 51 >10_08_0365 + 17224777-17224852,17224949-17224989,17225175-17225244, 17225338-17225486,17225940-17226035,17226481-17226551, 17227077-17227138,17227311-17227374,17227463-17227547, 17227631-17227757,17228241-17228374,17228808-17229122 Length = 429 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/25 (44%), Positives = 17/25 (68%) Frame = +2 Query: 392 YQLVRKLGRGKYSEVFEAINITNNE 466 Y+L RK+G G + E++ +NI N E Sbjct: 9 YKLGRKIGSGSFGELYLGVNIHNGE 33 >01_05_0406 + 21875376-21875451,21875570-21875610,21876245-21876314, 21876410-21876558,21876671-21876766,21876863-21876933, 21877119-21877267,21877400-21877463,21877547-21877631, 21878079-21878139,21879005-21879144,21879266-21879559 Length = 431 Score = 29.5 bits (63), Expect = 1.7 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +2 Query: 392 YQLVRKLGRGKYSEVFEAINITNNE 466 Y+L RKLG G + E++ N+ NE Sbjct: 9 YRLGRKLGSGSFGEIYLGTNVQTNE 33 >04_04_0503 - 25701050-25701343,25701431-25701528,25701629-25701689, 25701772-25701842,25701922-25702048,25702160-25702244, 25702346-25702409,25702732-25702793,25703214-25703284, 25703700-25703795,25703960-25704108,25704196-25704265, 25704483-25704523,25704668-25704743 Length = 454 Score = 29.1 bits (62), Expect = 2.3 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +2 Query: 392 YQLVRKLGRGKYSEVFEAINITNNE 466 ++L +K+G G + E++ A+NI N+E Sbjct: 9 FKLGKKIGSGSFGELYLAVNIQNSE 33 >01_01_0752 - 5808798-5810183 Length = 461 Score = 28.3 bits (60), Expect = 4.0 Identities = 10/25 (40%), Positives = 19/25 (76%) Frame = +2 Query: 392 YQLVRKLGRGKYSEVFEAINITNNE 466 Y+L R LG+G +++V+ A N+ +N+ Sbjct: 12 YELGRMLGQGTFAKVYHARNLASNQ 36 >01_01_0691 - 5328169-5328228,5328300-5328488,5328611-5328768, 5329677-5329767,5330359-5330438,5330472-5330533, 5330603-5330730,5331290-5331508,5331586-5331715, 5331804-5331870,5331968-5332062,5332150-5332221, 5332307-5332362,5332485-5332554,5332662-5332735, 5332820-5332954,5334135-5334314 Length = 621 Score = 28.3 bits (60), Expect = 4.0 Identities = 12/31 (38%), Positives = 19/31 (61%) Frame = +2 Query: 368 VDWGNQEDYQLVRKLGRGKYSEVFEAINITN 460 V GN Y+L RKLG+G + +V+ I++ Sbjct: 61 VQIGNSPTYKLERKLGKGGFGQVYVGRRISS 91 >04_01_0105 + 1098551-1100392 Length = 613 Score = 27.9 bits (59), Expect = 5.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -1 Query: 443 LQILHCISRDPACEPTDSLLGC 378 LQ+ H + RD EPT +L C Sbjct: 361 LQLFHAMERDHGVEPTPDILAC 382 >01_05_0438 + 22142646-22143659,22144319-22144858 Length = 517 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +2 Query: 365 VVDWGNQEDYQLVRKLGRGKYSEVFEAINITNNE 466 VV +G+ E Y +R +G G VF A ++ E Sbjct: 67 VVPFGSMESYDRLRLIGEGACGAVFRARHVATGE 100 >08_01_0469 - 4127950-4127988,4127989-4128264,4128845-4130861, 4131134-4131987 Length = 1061 Score = 27.5 bits (58), Expect = 6.9 Identities = 13/43 (30%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Frame = +2 Query: 290 VPSRARVYADVNSQRPREYWD--YESYVVDWGNQEDYQLVRKL 412 VP + A + + +PREYW Y S ++ G +D R++ Sbjct: 376 VPLAIIIIASLLANKPREYWSEVYNSIGLEHGYNDDVDNTRRI 418 >02_01_0457 - 3283759-3285240 Length = 493 Score = 27.5 bits (58), Expect = 6.9 Identities = 9/25 (36%), Positives = 20/25 (80%) Frame = +2 Query: 392 YQLVRKLGRGKYSEVFEAINITNNE 466 Y++ R+LG+G +++V+ A N+T+ + Sbjct: 12 YEIGRQLGQGNFAKVYYARNLTSGQ 36 >05_02_0102 - 6616497-6616601,6616652-6617884 Length = 445 Score = 27.1 bits (57), Expect = 9.1 Identities = 10/25 (40%), Positives = 18/25 (72%) Frame = +2 Query: 392 YQLVRKLGRGKYSEVFEAINITNNE 466 Y+L R LG G +S+V++A ++ + E Sbjct: 12 YELGRSLGHGTFSKVYQARSLVSGE 36 >02_05_1170 + 34663853-34663928,34664038-34664078,34664317-34664386, 34664499-34664647,34664784-34664879,34665406-34665476, 34665637-34665698,34665778-34665841,34665950-34666034, 34666129-34666255,34666381-34666454,34666539-34666599, 34666683-34666771,34666897-34667206,34667763-34667815, 34668299-34668370,34668648-34668914,34669015-34669047, 34669163-34669245,34669522-34669594,34669834-34670170, 34670302-34670633,34670816-34671135,34671261-34671612, 34671691-34671906 Length = 1170 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/25 (36%), Positives = 17/25 (68%) Frame = +2 Query: 392 YQLVRKLGRGKYSEVFEAINITNNE 466 ++L +K+G G + E+F A+N+ E Sbjct: 9 FKLGKKIGSGSFGELFLAVNVQTGE 33 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,830,493 Number of Sequences: 37544 Number of extensions: 217712 Number of successful extensions: 588 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 583 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 588 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -