BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G06f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0253 - 6319198-6319240,6319364-6319552,6319650-6319995,632... 30 1.3 02_02_0322 - 8938101-8938149,8938235-8938458,8938545-8938605,893... 28 4.0 03_01_0502 - 3779551-3779562,3779863-3780012,3780129-3780172,378... 28 5.2 09_04_0496 + 18079905-18081586,18084825-18084868,18086396-180865... 27 9.1 06_01_0614 + 4448129-4448157,4448733-4449231,4449512-4449550,444... 27 9.1 >09_02_0253 - 6319198-6319240,6319364-6319552,6319650-6319995, 6320811-6320893,6320977-6321074,6321384-6321461, 6321891-6322000,6322083-6322180,6323199-6323296, 6323403-6323463,6323688-6323831,6324103-6324206, 6324634-6324787,6324860-6324879,6324967-6325029, 6326521-6326632,6326711-6326796,6326872-6326899, 6327242-6327293,6329034-6329250 Length = 727 Score = 29.9 bits (64), Expect = 1.3 Identities = 13/48 (27%), Positives = 27/48 (56%), Gaps = 2/48 (4%) Frame = +3 Query: 252 FYIIKIFAGTTSKCVLAW*HI--HNICIYLKLMLVLCWLLQYRVFYTL 389 FY+ +FA C+L+ H+ +CI + +L+ C+ + Y ++Y + Sbjct: 260 FYMETLFAKHERLCMLSIDHVKLQYLCITIYHLLIACFTVNYFIYYLI 307 >02_02_0322 - 8938101-8938149,8938235-8938458,8938545-8938605, 8938724-8940761,8940797-8940908,8942037-8942047, 8942293-8942443 Length = 881 Score = 28.3 bits (60), Expect = 4.0 Identities = 14/43 (32%), Positives = 23/43 (53%) Frame = +1 Query: 175 CKFTRGDVLQVMHIKIKC*RFNLDCISTLSKFSRAQLQNVYLR 303 C T D LQ+++ +I C +F+L L F A L +Y++ Sbjct: 45 CGATLQDYLQIVY-RISCIKFSLSFKGFLKSFQSAYLVKIYIK 86 >03_01_0502 - 3779551-3779562,3779863-3780012,3780129-3780172, 3780256-3780319,3780422-3780655,3780765-3780908, 3781027-3781221,3781447-3781522,3781689-3781788, 3781955-3781988,3782076-3782160,3782226-3782290, 3782380-3782478,3782810-3782875,3785485-3785721 Length = 534 Score = 27.9 bits (59), Expect = 5.2 Identities = 16/56 (28%), Positives = 27/56 (48%) Frame = +3 Query: 252 FYIIKIFAGTTSKCVLAW*HIHNICIYLKLMLVLCWLLQYRVFYTLNLLRLSSRGG 419 F+ +K F GT K + A I +C+ L L + + Y V + + ++RGG Sbjct: 409 FWSLKDFHGTVQKAITADKSIKAVCLVLFAFLGVPLAVLYSVPFAVTAQLAATRGG 464 >09_04_0496 + 18079905-18081586,18084825-18084868,18086396-18086502, 18087069-18087674,18087789-18088013,18088102-18088167, 18088268-18088336,18088511-18088582,18088672-18088848, 18089978-18090115 Length = 1061 Score = 27.1 bits (57), Expect = 9.1 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -3 Query: 387 MCKKLCIEVTNTKQASVLNIYIYCVCVTTQVHILK 283 +C+K IEV ++++N+Y C C+ VH+ + Sbjct: 237 VCRK-GIEVEERLSSALINMYSKCGCIEGAVHVFE 270 >06_01_0614 + 4448129-4448157,4448733-4449231,4449512-4449550, 4449590-4449802,4449941-4450227,4450456-4450567, 4451515-4451751,4451857-4451957,4452285-4452384, 4452509-4453141 Length = 749 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +3 Query: 246 LYFYIIKIFAGTTSKCV 296 LYFY+ KI+ GT + C+ Sbjct: 84 LYFYVPKIYYGTPNSCI 100 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,940,489 Number of Sequences: 37544 Number of extensions: 248624 Number of successful extensions: 444 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 437 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 444 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -