BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G06f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 26 0.67 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 8.2 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 26.2 bits (55), Expect = 0.67 Identities = 10/43 (23%), Positives = 23/43 (53%) Frame = -3 Query: 414 PSRTNAINLMCKKLCIEVTNTKQASVLNIYIYCVCVTTQVHIL 286 PSR + + ++ L + ++ KQ++ L+ C CV + ++ Sbjct: 35 PSRRSRLCIIALSLTLSSSSCKQSTSLSFVFLCCCVPSSERLI 77 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 22.6 bits (46), Expect = 8.2 Identities = 14/43 (32%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = -1 Query: 272 ENFDNVEIQSRLNR*HFILMCMTCNT-SPLVNLHYMLMDYSNL 147 E F ++ LN H L + +T SP+ NLH +L+ ++ L Sbjct: 386 EIFSDLYTLQILNLRHNQLEIIAADTFSPMNNLHTLLLSHNKL 428 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 547,098 Number of Sequences: 2352 Number of extensions: 11994 Number of successful extensions: 61 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 61 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -