BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G06f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF036698-1|AAB88352.1| 425|Caenorhabditis elegans Hypothetical ... 28 4.7 AC024794-6|AAK68493.2| 425|Caenorhabditis elegans Hypothetical ... 28 4.7 >AF036698-1|AAB88352.1| 425|Caenorhabditis elegans Hypothetical protein B0273.3 protein. Length = 425 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -1 Query: 281 CAR-ENFDNVEIQSRLNR*HFILMCMTCNTSPLVNLHYMLMDYSNLSERS 135 C R E+ NVE RL +F + C+T + H+M++D+ NL S Sbjct: 331 CLRDESHTNVEFPRRLVERNF--RRIACDTCKEASAHWMIVDHDNLLPNS 378 >AC024794-6|AAK68493.2| 425|Caenorhabditis elegans Hypothetical protein Y48G1BM.1 protein. Length = 425 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = -1 Query: 281 CAR-ENFDNVEIQSRLNR*HFILMCMTCNTSPLVNLHYMLMDYSNLSERS 135 C R E+ NVE RL +F + C+T + H+M++D+ NL S Sbjct: 331 CLRDESHTNVEFPRRLVERNF--RRIACDTCKEASAHWMIVDHDNLLPNS 378 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,828,153 Number of Sequences: 27780 Number of extensions: 251821 Number of successful extensions: 572 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 559 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 571 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -