BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G05f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 2.9 AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neu... 22 3.8 U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. 21 8.7 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.2 bits (45), Expect = 2.9 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +3 Query: 135 LREHGAVHHLVR 170 LRE G +HHL R Sbjct: 360 LREEGWIHHLAR 371 >AY695257-1|AAW21974.1| 224|Tribolium castaneum intermediate neuroblasts defectiveprotein protein. Length = 224 Score = 21.8 bits (44), Expect = 3.8 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 99 VPSPRRPSLEASEKEAVAASLSP 31 +PSP+R S +EK +V+ + P Sbjct: 77 IPSPKRSSPILAEKVSVSPTTPP 99 >U09586-1|AAC47270.1| 425|Tribolium castaneum ORF 1 protein. Length = 425 Score = 20.6 bits (41), Expect = 8.7 Identities = 10/31 (32%), Positives = 16/31 (51%) Frame = -3 Query: 147 HVPATERSWRSRAPGCVPSPRRPSLEASEKE 55 +V A RS +P+P RPS E +++ Sbjct: 127 NVAAISGVLRSLLDRPLPAPERPSFEGLKRQ 157 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,382 Number of Sequences: 336 Number of extensions: 2313 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -