BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G05f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 28 0.22 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 3.6 AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-spe... 23 6.2 AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-spe... 23 8.2 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 27.9 bits (59), Expect = 0.22 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 183 HASAGAPDDERRHVPATERSWRSRAPGCVPSP 88 H+ PD ++R P +RS P VP P Sbjct: 1082 HSDVTTPDYDQRSTPTPQRSHTQAGPRVVPDP 1113 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 3.6 Identities = 13/49 (26%), Positives = 22/49 (44%), Gaps = 2/49 (4%) Frame = +1 Query: 256 VWRRSW--KAPLEPCIF*PKESHNRXLIRXQNVIPIFVQLXXNEIENIQ 396 +W+ W +AP PC P + R L+ + P ++ENI+ Sbjct: 184 MWQGMWEYRAPNAPCFTAPVKPKARNLLSSVSTTPSPEVFSPKKMENIE 232 >AF043433-3|AAC05658.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinprotein. Length = 231 Score = 23.0 bits (47), Expect = 6.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 105 GCVPSPRRPSLEASEKEAVAASLSPAIHNAGVLHS 1 G +P S+ AS + +PAIH+ G +H+ Sbjct: 18 GLLPVAHHGSI-ASSHSTIQHHAAPAIHHVGSVHA 51 >AF043441-1|AAC05666.1| 231|Anopheles gambiae putative pupal-specific cuticular proteinCP2b protein. Length = 231 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/35 (28%), Positives = 19/35 (54%) Frame = -3 Query: 105 GCVPSPRRPSLEASEKEAVAASLSPAIHNAGVLHS 1 G +P S+ A+ ++ +PAIH+ G +H+ Sbjct: 18 GLLPVANHGSI-ATSHSSIQHHAAPAIHHVGSIHA 51 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 523,238 Number of Sequences: 2352 Number of extensions: 9856 Number of successful extensions: 29 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -