BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G01f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 22 3.8 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 22 3.8 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 6.6 AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory recept... 21 8.7 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 427 KAR*PNNVALDAIDGGAPP 371 K + P ++ +D DGG PP Sbjct: 24 KGKMPIDLVIDERDGGKPP 42 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 21.8 bits (44), Expect = 3.8 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -2 Query: 427 KAR*PNNVALDAIDGGAPP 371 K + P ++ +D DGG PP Sbjct: 180 KGKMPIDLVIDERDGGKPP 198 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.0 bits (42), Expect = 6.6 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = +1 Query: 409 CLVNELLQTEGLQCQQLYLKLILIQCRV*VICH 507 C+V +L + + LQ L L V ICH Sbjct: 895 CVVLQLQENDWLQLGYLIFVSTLYTANVVCICH 927 >AM292372-1|CAL23184.2| 771|Tribolium castaneum gustatory receptor candidate 51 protein. Length = 771 Score = 20.6 bits (41), Expect = 8.7 Identities = 7/17 (41%), Positives = 11/17 (64%) Frame = -2 Query: 73 KNILNITENEFESDIYY 23 +N L + +FES +YY Sbjct: 340 ENFLQCQDEKFESFVYY 356 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,994 Number of Sequences: 336 Number of extensions: 2055 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -