BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G01f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0990 + 7847066-7847478,7847713-7848679 27 6.9 01_06_0405 + 29103723-29103839,29103928-29104012,29104572-291046... 27 9.1 >01_01_0990 + 7847066-7847478,7847713-7848679 Length = 459 Score = 27.5 bits (58), Expect = 6.9 Identities = 14/46 (30%), Positives = 17/46 (36%) Frame = -1 Query: 458 SCWHCNPSVCKSSLTKQRSSRCH*WGSSAWHCS*ITARRQGAPKSW 321 SC H NPS LT + C G W C ++R W Sbjct: 72 SCVHHNPSRALGDLTGIKKHFCRKHGEKKWKCD-KCSKRYAVQSDW 116 >01_06_0405 + 29103723-29103839,29103928-29104012,29104572-29104674, 29104798-29104882,29105414-29105497,29105627-29105730, 29106522-29106783,29106978-29107414,29107637-29107718, 29109913-29110089,29110640-29110732,29110812-29110877, 29110992-29111038,29111165-29111430,29111443-29111845, 29111992-29112376 Length = 931 Score = 27.1 bits (57), Expect = 9.1 Identities = 9/21 (42%), Positives = 17/21 (80%) Frame = +2 Query: 86 IIMRPSDPFICSPIGIIRKDE 148 +++RPSDPF PIG++ +++ Sbjct: 51 VVLRPSDPF---PIGVVNRED 68 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,995,555 Number of Sequences: 37544 Number of extensions: 243079 Number of successful extensions: 637 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 626 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 637 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -