BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308G01f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 24 0.82 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 22 3.3 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 22 3.3 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 24.2 bits (50), Expect = 0.82 Identities = 13/50 (26%), Positives = 25/50 (50%) Frame = -2 Query: 178 PAKCRKLGGSFIFPNDSDR*TDEWIGRSHYNKTQPKNILNITENEFESDI 29 P K +KL FIFP +++ + + +S+ + + ++L E E I Sbjct: 120 PTKHQKLDQKFIFPQENNYNDNYFYSKSNGSNSSNSDVLFKQNKEEEQTI 169 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 115 DEWIGRSHYNKTQPKN 68 D WIGRS + PK+ Sbjct: 191 DAWIGRSFIDYVHPKD 206 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 22.2 bits (45), Expect = 3.3 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 115 DEWIGRSHYNKTQPKN 68 D WIGRS + PK+ Sbjct: 186 DAWIGRSFIDYVHPKD 201 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 129,210 Number of Sequences: 438 Number of extensions: 2431 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -