BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F11f (477 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 ... 25 0.36 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 23 1.4 L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protei... 21 7.7 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 21 7.7 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 21 7.7 >AY920544-1|AAX62142.1| 463|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 463 Score = 25.0 bits (52), Expect = 0.36 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 187 LVQPDGVHRIVEYTSDKVNGFNANVRYEGHPVAQPAKI 300 +V+PD +H ++E K+ N+N EG + ++I Sbjct: 218 IVRPDLIHLLMEARKGKLKHDNSNEGGEGFATVEESEI 255 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 23.0 bits (47), Expect = 1.4 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +2 Query: 401 PTAHPSLRSHTPPQLPRSPTT 463 P +LR H P + PR+P T Sbjct: 103 PIVRCALRKHKPNRKPRTPFT 123 >L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protein protein. Length = 74 Score = 20.6 bits (41), Expect = 7.7 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -3 Query: 469 EHCCRRSWQLGRCMRP*RWVRCRRSWQQEHC 377 EHC R+ Q+ R R R + EHC Sbjct: 41 EHCDRQFVQVANLRRHLRVHTGERPYGCEHC 71 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 20.6 bits (41), Expect = 7.7 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -1 Query: 438 GGVCDLSDG 412 GGVC +SDG Sbjct: 388 GGVCRISDG 396 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 20.6 bits (41), Expect = 7.7 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = -3 Query: 469 EHCCRRSWQLGRCMRP*RWVRCRRSWQQEHC 377 EHC R+ Q+ R R R + EHC Sbjct: 194 EHCDRQFVQVANLRRHLRVHTGERPYGCEHC 224 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.314 0.129 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 70,347 Number of Sequences: 336 Number of extensions: 1142 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 11141978 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.1 bits)
- SilkBase 1999-2023 -