BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F11f (477 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BC036533-1|AAH36533.1| 748|Homo sapiens junctophilin 3 protein. 32 1.2 AB042640-1|BAB11987.1| 620|Homo sapiens junctophilin type3 prot... 32 1.2 AB042636-1|BAB11983.1| 748|Homo sapiens junctophilin type3 prot... 32 1.2 AK125511-1|BAC86188.1| 559|Homo sapiens rome) (ELN). protein. 31 2.7 CR589951-1|CAM12871.1| 712|Homo sapiens phosphatase and actin r... 29 8.3 CR391992-3|CAM12872.1| 712|Homo sapiens phosphatase and actin r... 29 8.3 CR391992-2|CAI20111.2| 702|Homo sapiens phosphatase and actin r... 29 8.3 BC068508-1|AAH68508.1| 630|Homo sapiens PHACTR4 protein protein. 29 8.3 BC029266-1|AAH29266.1| 702|Homo sapiens phosphatase and actin r... 29 8.3 BC021247-1|AAH21247.2| 686|Homo sapiens PHACTR4 protein protein. 29 8.3 AL840643-2|CAM12873.1| 712|Homo sapiens phosphatase and actin r... 29 8.3 AL840643-1|CAH73869.2| 702|Homo sapiens phosphatase and actin r... 29 8.3 AL670471-1|CAM12870.1| 702|Homo sapiens phosphatase and actin r... 29 8.3 AK025436-1|BAB15130.1| 654|Homo sapiens protein ( Homo sapiens ... 29 8.3 AK023233-1|BAB14483.1| 373|Homo sapiens protein ( Homo sapiens ... 29 8.3 >BC036533-1|AAH36533.1| 748|Homo sapiens junctophilin 3 protein. Length = 748 Score = 31.9 bits (69), Expect = 1.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 85 AHYDFEYSVHDQQSGDIKQQKESRAGDAVQGFYSLVQPDG 204 AH+ + SV +++ GDI+ E RAGD + + Q G Sbjct: 499 AHFSRQVSVDEERGGDIQMLLEGRAGDCARSSWGEEQAGG 538 >AB042640-1|BAB11987.1| 620|Homo sapiens junctophilin type3 protein. Length = 620 Score = 31.9 bits (69), Expect = 1.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 85 AHYDFEYSVHDQQSGDIKQQKESRAGDAVQGFYSLVQPDG 204 AH+ + SV +++ GDI+ E RAGD + + Q G Sbjct: 371 AHFSRQVSVDEERGGDIQMLLEGRAGDCARSSWGEEQAGG 410 >AB042636-1|BAB11983.1| 748|Homo sapiens junctophilin type3 protein. Length = 748 Score = 31.9 bits (69), Expect = 1.2 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +1 Query: 85 AHYDFEYSVHDQQSGDIKQQKESRAGDAVQGFYSLVQPDG 204 AH+ + SV +++ GDI+ E RAGD + + Q G Sbjct: 499 AHFSRQVSVDEERGGDIQMLLEGRAGDCARSSWGEEQAGG 538 >AK125511-1|BAC86188.1| 559|Homo sapiens rome) (ELN). protein. Length = 559 Score = 30.7 bits (66), Expect = 2.7 Identities = 13/33 (39%), Positives = 13/33 (39%) Frame = -3 Query: 460 CRRSWQLGRCMRP*RWVRCRRSWQQEHCRRSWL 362 C W C RP W C SW C SWL Sbjct: 523 CWHPWTWSWCRRPWTWSWCWCSWTWSWCWCSWL 555 >CR589951-1|CAM12871.1| 712|Homo sapiens phosphatase and actin regulator 4 protein. Length = 712 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 347 MISPRSPS--PPLPTHIPPEPPRTP 369 >CR391992-3|CAM12872.1| 712|Homo sapiens phosphatase and actin regulator 4 protein. Length = 712 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 347 MISPRSPS--PPLPTHIPPEPPRTP 369 >CR391992-2|CAI20111.2| 702|Homo sapiens phosphatase and actin regulator 4 protein. Length = 702 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 337 MISPRSPS--PPLPTHIPPEPPRTP 359 >BC068508-1|AAH68508.1| 630|Homo sapiens PHACTR4 protein protein. Length = 630 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 321 MISPRSPS--PPLPTHIPPEPPRTP 343 >BC029266-1|AAH29266.1| 702|Homo sapiens phosphatase and actin regulator 4 protein. Length = 702 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 337 MISPRSPS--PPLPTHIPPEPPRTP 359 >BC021247-1|AAH21247.2| 686|Homo sapiens PHACTR4 protein protein. Length = 686 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 321 MISPRSPS--PPLPTHIPPEPPRTP 343 >AL840643-2|CAM12873.1| 712|Homo sapiens phosphatase and actin regulator 4 protein. Length = 712 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 347 MISPRSPS--PPLPTHIPPEPPRTP 369 >AL840643-1|CAH73869.2| 702|Homo sapiens phosphatase and actin regulator 4 protein. Length = 702 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 337 MISPRSPS--PPLPTHIPPEPPRTP 359 >AL670471-1|CAM12870.1| 702|Homo sapiens phosphatase and actin regulator 4 protein. Length = 702 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 337 MISPRSPS--PPLPTHIPPEPPRTP 359 >AK025436-1|BAB15130.1| 654|Homo sapiens protein ( Homo sapiens cDNA: FLJ21783 fis, clone HEP00284. ). Length = 654 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 289 MISPRSPS--PPLPTHIPPEPPRTP 311 >AK023233-1|BAB14483.1| 373|Homo sapiens protein ( Homo sapiens cDNA FLJ13171 fis, clone NT2RP3003819. ). Length = 373 Score = 29.1 bits (62), Expect = 8.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +2 Query: 383 LLLPRSPTAHPSLRSHTPPQLPRSP 457 ++ PRSP+ P L +H PP+ PR+P Sbjct: 8 MISPRSPS--PPLPTHIPPEPPRTP 30 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.314 0.129 0.371 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 47,259,439 Number of Sequences: 237096 Number of extensions: 746413 Number of successful extensions: 4106 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 3642 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4104 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 4213781852 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.6 bits)
- SilkBase 1999-2023 -