BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F10f (478 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49561| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.0 SB_15481| Best HMM Match : FlaG (HMM E-Value=5.9) 27 7.9 >SB_49561| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 178 Score = 27.5 bits (58), Expect = 6.0 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +2 Query: 125 GXMXKVIFPVQNXMPH*CYTYPSDGEXXPS 214 G M IFP++ M H PSD E PS Sbjct: 147 GYMDSGIFPIEEDMSHDYDEVPSDDEHAPS 176 >SB_15481| Best HMM Match : FlaG (HMM E-Value=5.9) Length = 272 Score = 27.1 bits (57), Expect = 7.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 355 FKHCTKQPLXTINHCFKXQYSRYSQRNVNEKCXH 254 FKH P+ I H K Y R S + EKC H Sbjct: 124 FKHGPGLPVAFI-HAIKPTYQRLSDPELLEKCLH 156 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,913,740 Number of Sequences: 59808 Number of extensions: 108711 Number of successful extensions: 96 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 84 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 96 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 989515521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -