BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F09f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_04_0129 + 17520753-17520842,17521651-17521741,17521887-175220... 158 2e-39 07_03_0493 + 18747427-18748356,18748594-18748697,18749586-187497... 28 4.0 11_01_0645 + 5185341-5185568,5185773-5185823 27 6.9 03_02_0901 + 12267042-12267182,12267949-12268095,12268163-122682... 27 6.9 01_06_1208 + 35424241-35424370,35424415-35424728,35424782-354249... 27 9.1 >03_04_0129 + 17520753-17520842,17521651-17521741,17521887-17522070, 17522149-17522224 Length = 146 Score = 158 bits (384), Expect = 2e-39 Identities = 67/122 (54%), Positives = 95/122 (77%) Frame = +1 Query: 7 KIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHIYIRSPVGV 186 + VK +AHLK++GK+++PE +D+VKTARFKEL PYDPDW+Y R A+I R IY+R +GV Sbjct: 16 EFVKAYSAHLKRSGKMELPEWVDIVKTARFKELPPYDPDWYYTRAASIARKIYLRQGIGV 75 Query: 187 KTVTKIFGGRKRNGVTPSHFCRSSGSIARKALQSLEALKLVEKVQDGGRILTTQGRRDLD 366 KI+GGR+RNG P HFC+SSG+I+R LQ L+ + +++ GGR++T+QGRRDLD Sbjct: 76 GGFQKIYGGRQRNGSRPPHFCKSSGAISRNILQQLQKMGIIDVDPKGGRLITSQGRRDLD 135 Query: 367 RI 372 ++ Sbjct: 136 QV 137 >07_03_0493 + 18747427-18748356,18748594-18748697,18749586-18749795, 18749992-18750597,18750819-18751095,18751163-18751310, 18751957-18752044,18752167-18752284 Length = 826 Score = 28.3 bits (60), Expect = 4.0 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = -2 Query: 214 AHQRSW*QSLLQQVSECKYDEGWQHNAHRTNQGHTEPAL*SELSLQDPCAQV 59 A QR Q L VS EGWQH++ + L E+ ++ AQV Sbjct: 671 ADQRVSAQCSLAPVSHLHQQEGWQHSSFEHQHHENQNFLEMEVRVRSEMAQV 722 >11_01_0645 + 5185341-5185568,5185773-5185823 Length = 92 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/39 (28%), Positives = 20/39 (51%) Frame = +1 Query: 160 IYIRSPVGVKTVTKIFGGRKRNGVTPSHFCRSSGSIARK 276 ++ +SP + + + GR+R G P R +G IA + Sbjct: 18 VHCKSPAALLGIESPYSGRRRVGARPRGGSRQAGQIAER 56 >03_02_0901 + 12267042-12267182,12267949-12268095,12268163-12268253, 12268367-12268485,12268779-12268969,12269440-12269650, 12270072-12270309,12270944-12271329,12271933-12271956, 12271984-12272077,12272341-12272525,12273025-12273255, 12273665-12273730,12273816-12274034,12274764-12275003, 12275244-12275423,12276269-12276535,12276612-12276815, 12276896-12277048 Length = 1128 Score = 27.5 bits (58), Expect = 6.9 Identities = 17/55 (30%), Positives = 28/55 (50%) Frame = +1 Query: 1 QDKIVKTVAAHLKKTGKVKVPEHMDLVKTARFKELAPYDPDWFYVRCAAILRHIY 165 +D+I+ + ++ V+VP + +LV TA L P D W +R A LR + Sbjct: 947 EDRILMSDIVFMRAWVNVEVPTYCNLVTTA----LQPQDETWQGMRTTAELRRAH 997 >01_06_1208 + 35424241-35424370,35424415-35424728,35424782-35424967, 35425361-35425523,35425601-35425787,35425875-35426016 Length = 373 Score = 27.1 bits (57), Expect = 9.1 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 328 HRPELSQQASMPPTIAKPCVQYCLMTCRN 242 H + + + P TIA+ +QYCL TC N Sbjct: 116 HPTQDPEATNSPFTIAQLQLQYCLHTCTN 144 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,607,107 Number of Sequences: 37544 Number of extensions: 257268 Number of successful extensions: 630 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 630 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -