BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F08f (456 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value S81591-1|AAB36180.1| 698|Homo sapiens Na+/H+ exchanger protein. 32 1.1 >S81591-1|AAB36180.1| 698|Homo sapiens Na+/H+ exchanger protein. Length = 698 Score = 31.9 bits (69), Expect = 1.1 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 190 STAGLSNLPKNKSVPRNLEEPYAVVKVDGNSAXKKLEXT 306 ST+ +LPKN +P L++ V DGNS+ ++ T Sbjct: 549 STSRYLSLPKNTKLPEKLQKKNKVSNADGNSSDSDMDGT 587 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 50,100,551 Number of Sequences: 237096 Number of extensions: 767729 Number of successful extensions: 1815 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 1658 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1815 length of database: 76,859,062 effective HSP length: 84 effective length of database: 56,942,998 effective search space used: 3815180866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -