BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F08f (456 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g29970.1 68415.m03645 heat shock protein-related contains sim... 28 3.4 At1g65840.1 68414.m07470 amine oxidase family protein similar to... 27 4.5 >At2g29970.1 68415.m03645 heat shock protein-related contains similarity to 101 kDa heat shock protein; HSP101 [Triticum aestivum] gi|11561808|gb|AAC83689 Length = 1002 Score = 27.9 bits (59), Expect = 3.4 Identities = 15/54 (27%), Positives = 29/54 (53%), Gaps = 1/54 (1%) Frame = +1 Query: 124 VKFSVMKKSISTPDITLE-DSPYSTAGLSNLPKNKSVPRNLEEPYAVVKVDGNS 282 V + S STP T+E D P S + ++ + ++++ R E Y + ++ GN+ Sbjct: 81 VSLDRLPSSKSTPTTTVEEDPPVSNSLMAAIKRSQATQRRHPETYHLHQIHGNN 134 >At1g65840.1 68414.m07470 amine oxidase family protein similar to polyamine oxidase SP:O64411 [Zea mays]; contains Pfam profile PF01593 amine oxidase, flavin-containing Length = 497 Score = 27.5 bits (58), Expect = 4.5 Identities = 20/64 (31%), Positives = 28/64 (43%), Gaps = 1/64 (1%) Frame = +1 Query: 49 SFQCFCDSGACTLHCKNRESP-TDFIVKFSVMKKSISTPDITLEDSPYSTAGLSNLPKNK 225 SF C D GA LH + E+P I + + S D L D + GL ++ NK Sbjct: 72 SFGCPVDMGASWLHGVSDENPLAPIIRRLGLTLYRTSGDDSILYDHDLESYGLFDMHGNK 131 Query: 226 SVPR 237 P+ Sbjct: 132 IPPQ 135 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.133 0.382 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,860,568 Number of Sequences: 28952 Number of extensions: 125648 Number of successful extensions: 314 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 312 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 314 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 752336160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -