BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F06f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal... 29 0.072 M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. 28 0.22 AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 27 0.29 AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. 26 0.67 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 25 1.2 AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding pr... 25 1.2 AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding pr... 25 1.2 AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical prote... 25 1.5 AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-conta... 25 2.0 DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosylt... 24 2.7 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 24 2.7 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 3.6 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 8.2 >AJ301655-1|CAC35008.1| 1433|Anopheles gambiae putative epidermal growth factor receptorprotein. Length = 1433 Score = 29.5 bits (63), Expect = 0.072 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -1 Query: 470 LEVLDHMGSRQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQ 336 L+ L H +Q++QQ+Q + ++ +QHQ + H P L Q Sbjct: 1297 LQTLQHQ-YQQQLQQQQQQQQQQQQQHQQHQQHQLQHHHQPQLSQ 1340 >M93690-1|AAA29364.1| 613|Anopheles gambiae ORF1 protein. Length = 613 Score = 27.9 bits (59), Expect = 0.22 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = -1 Query: 443 RQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQEVPH 321 +Q+ QQ++ + RE +Q QH +Q + ++QQ H Sbjct: 247 QQQQQQQRNQQREWQQQQQQQQHQQREQQQQQRVQQQNQQH 287 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 27.5 bits (58), Expect = 0.29 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = +1 Query: 220 DSSTGLRSCRSPCCNSICCSYSCTLRCTFCYSNRCGTSC 336 D + R R PCC+++ C C + +S R +C Sbjct: 162 DDARRNRRDRQPCCSTLLCVVVVPFCCRYWHSLRLSYAC 200 >AY645022-1|AAT92558.1| 165|Anopheles gambiae hairy protein. Length = 165 Score = 26.2 bits (55), Expect = 0.67 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 73 SSNYKGSSDEYDRFEREH 20 SS + GSS YDR REH Sbjct: 49 SSGHSGSSSLYDRVPREH 66 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 235 LRSCRSPCCNSICCSYSCTLRCTFCYSNRCGTSCCSSSGI 354 LRSC C+S C+ S ++C+ C + + S +G+ Sbjct: 19 LRSCS---CHSSVCAVSFVMQCSTCNAPTDSANSVSCAGV 55 >AY146760-1|AAO12075.1| 313|Anopheles gambiae odorant-binding protein AgamOBP31 protein. Length = 313 Score = 25.4 bits (53), Expect = 1.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 19 DVLSQIYRTHRCCL 60 DV S++Y THR CL Sbjct: 242 DVCSEVYNTHRDCL 255 >AF393487-1|AAL60412.1| 304|Anopheles gambiae odorant binding protein 1 protein. Length = 304 Score = 25.4 bits (53), Expect = 1.2 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = +1 Query: 19 DVLSQIYRTHRCCL 60 DV S++Y THR CL Sbjct: 242 DVCSEVYNTHRDCL 255 >AJ297930-1|CAC35450.1| 104|Anopheles gambiae hypothetical protein protein. Length = 104 Score = 25.0 bits (52), Expect = 1.5 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -2 Query: 238 EGRCCYQRTQCP 203 EG+CC +R QCP Sbjct: 46 EGQCCPKRYQCP 57 >AJ439353-3|CAD27925.1| 1200|Anopheles gambiae putative TPR-containing phosphoprotein protein. Length = 1200 Score = 24.6 bits (51), Expect = 2.0 Identities = 22/67 (32%), Positives = 28/67 (41%) Frame = -2 Query: 430 SRSRESVGSRWQDWSSTSIVWRSSIGCRYWSSKRCRTYWSSKRCSVGCSYRSSKWSCNRG 251 SRSR GSR + S + S G R S R R+ S+ S S + S+ G Sbjct: 1067 SRSRSGSGSRSRSRSGSG----SRAGSRAGSGSRSRSRSRSRSRSRSGSAKGSRSRSRSG 1122 Query: 250 YGRSEGR 230 G S R Sbjct: 1123 SGGSRSR 1129 >DQ139954-1|ABA29475.1| 451|Anopheles gambiae protein O-fucosyltransferase 2 protein. Length = 451 Score = 24.2 bits (50), Expect = 2.7 Identities = 14/36 (38%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Frame = -2 Query: 130 WSNQRSSGYCWNSCD-CTRFSSNYKGSSDEYDRFER 26 W +RS + D TRF + Y SSD DR R Sbjct: 251 WEARRSMRFAPPLVDVATRFRAEYLNSSDRADRTVR 286 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = -1 Query: 443 RQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQEVP 324 R + QQ+Q + ++ +Q Q +QH+ P + Q P Sbjct: 1298 RSQQQQQQQQQQQQQQQQQQQQQQQQQQHQPPSTQAQLRP 1337 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 3.6 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 443 RQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQE 330 RQ+ QQ+Q + R+ +Q Q Q + +QQ+ Sbjct: 336 RQQQQQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQ 373 Score = 23.8 bits (49), Expect = 3.6 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -1 Query: 443 RQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQ 333 +Q+ QQ+QGE P +Q Q +Q + +QQ Sbjct: 440 QQQQQQQQGERYVPPQLRQQRQQQQPQQQQQQRPQQQ 476 Score = 23.4 bits (48), Expect = 4.7 Identities = 13/41 (31%), Positives = 21/41 (51%), Gaps = 3/41 (7%) Frame = -1 Query: 443 RQRMQQEQGECREP---LAGLEQHQHSMAKQHRMPLLEQQE 330 +Q+ QQ+QGE P +Q QH +Q + +QQ+ Sbjct: 286 QQQQQQQQGERYVPPQLRQQRQQQQHQQQQQQQQQQRQQQQ 326 Score = 23.4 bits (48), Expect = 4.7 Identities = 10/41 (24%), Positives = 21/41 (51%) Frame = -1 Query: 443 RQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQEVPH 321 +QR QQ++ + ++ +Q Q +Q + +Q +PH Sbjct: 345 QQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQPRQSLPH 385 Score = 22.6 bits (46), Expect = 8.2 Identities = 11/38 (28%), Positives = 19/38 (50%) Frame = -1 Query: 443 RQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQE 330 +Q+ QQ+QGE P +Q Q + + +QQ+ Sbjct: 253 QQQQQQQQGERYVPPQLRQQRQQQQRPRQQQQQQQQQQ 290 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/40 (25%), Positives = 20/40 (50%) Frame = -1 Query: 443 RQRMQQEQGECREPLAGLEQHQHSMAKQHRMPLLEQQEVP 324 +Q+ QQ++ + + +Q QH +Q +QQ+ P Sbjct: 340 QQQQQQQRQQQQRQQQQQQQQQHQQQQQQWQQQQQQQQQP 379 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -1 Query: 437 RMQQEQGECREPLAGLEQHQHSMAKQHRMP 348 + QQ+Q + + G+ QHQ +Q R P Sbjct: 285 QQQQQQRQLQRQAVGIAQHQQQ--QQQRQP 312 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 423,869 Number of Sequences: 2352 Number of extensions: 8753 Number of successful extensions: 59 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 57 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -