BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F04f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 27 0.076 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 21 5.0 DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. 21 6.6 AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 prot... 21 8.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 27.5 bits (58), Expect = 0.076 Identities = 23/77 (29%), Positives = 31/77 (40%), Gaps = 7/77 (9%) Frame = +3 Query: 267 RFISQENSDSEMWLDFNGQPLKWHYPIGFLYDLYCGNDPQ----LPWTLTVHFTKFPEDI 434 RFI E W +F+G L W YP + D G D W + P+ Sbjct: 1498 RFIKHVLQFLEKW-NFDGLDLDWEYPKCWQVDCKKGPDSDKQAFAAWVTELKQAFKPKGY 1556 Query: 435 LLHC---PNKDVVEAHY 476 LL P+K V++A Y Sbjct: 1557 LLSAAVSPSKTVIDAGY 1573 Score = 23.4 bits (48), Expect = 1.2 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = +3 Query: 225 YFPLVIDKMKRHFLRFISQENSDSEMWLDFNGQPLKWHYPIGFLYDLYCGND 380 Y LV D R FI+ + E W +F+G L W YP + D G D Sbjct: 2409 YSRLVNDPQAR--AAFIAHVLAFIEEW-NFDGLDLDWEYPKCWQVDCNKGPD 2457 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +3 Query: 309 DFNGQPLKWHYPI 347 +F G L W+YP+ Sbjct: 748 NFKGLHLDWNYPV 760 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 21.4 bits (43), Expect = 5.0 Identities = 7/13 (53%), Positives = 8/13 (61%) Frame = +3 Query: 312 FNGQPLKWHYPIG 350 FNG + W YP G Sbjct: 632 FNGLDVDWEYPRG 644 >DQ138189-1|ABA03053.1| 162|Tribolium castaneum bursicon protein. Length = 162 Score = 21.0 bits (42), Expect = 6.6 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = +1 Query: 349 DFCTICIVVMILNYPG 396 D C + V+ +L YPG Sbjct: 39 DECQVTPVIHVLQYPG 54 >AY873913-1|AAW67569.2| 377|Tribolium castaneum chitinase 2 protein. Length = 377 Score = 20.6 bits (41), Expect = 8.7 Identities = 6/11 (54%), Positives = 7/11 (63%) Frame = +3 Query: 312 FNGQPLKWHYP 344 FNG + W YP Sbjct: 138 FNGLDIDWEYP 148 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 130,430 Number of Sequences: 336 Number of extensions: 3209 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -