BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F02f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g62830.1 68414.m07093 amine oxidase family protein / SWIRM do... 30 1.1 At2g20240.1 68415.m02365 expressed protein 28 4.4 >At1g62830.1 68414.m07093 amine oxidase family protein / SWIRM domain-containing protein contains Pfam profile: PF01593 Flavin containing amine oxidase Length = 844 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/45 (26%), Positives = 25/45 (55%) Frame = +3 Query: 384 LEAECFSDLQGPSNCAFIQIRNRILKMWFADPKKQLTQEQAVKKM 518 +EA S + G +I +RN I+ +W ++ LT++ A++ + Sbjct: 179 IEANVVSIIGGKDQANYIVVRNHIIALWRSNVSNWLTRDHALESI 223 >At2g20240.1 68415.m02365 expressed protein Length = 713 Score = 27.9 bits (59), Expect = 4.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 436 INAQFEGPCKSEKHSASSDDILSNG 362 I EG C++E S+SS +LSNG Sbjct: 253 IRETVEGHCRNETLSSSSSSVLSNG 277 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,822,079 Number of Sequences: 28952 Number of extensions: 138753 Number of successful extensions: 294 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 290 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -