BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308F01f (521 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U53339-4|AAA96200.1| 298|Caenorhabditis elegans Hypothetical pr... 28 4.7 AF022980-11|AAG24189.1| 330|Caenorhabditis elegans Serpentine r... 27 6.2 >U53339-4|AAA96200.1| 298|Caenorhabditis elegans Hypothetical protein F58A6.5 protein. Length = 298 Score = 27.9 bits (59), Expect = 4.7 Identities = 24/78 (30%), Positives = 38/78 (48%), Gaps = 2/78 (2%) Frame = +3 Query: 294 FALIFLAEYSSILFIRMILVII-NMGGYNLRFFFYLKLRLISFLFI*VRGTLPRY-RYDK 467 F +IFL +IL I +++ +I + YNLR + R+ S FI V+ L + D Sbjct: 127 FGIIFL-NLGAILVITIVIPLIASYVYYNLRVRSLAEKRIASCAFIFVQSVLIGFINQDD 185 Query: 468 LIYLAXKKIFTYFIKLFI 521 + A +FT I F+ Sbjct: 186 WVESAPFTVFTQMIASFV 203 >AF022980-11|AAG24189.1| 330|Caenorhabditis elegans Serpentine receptor, class j protein49 protein. Length = 330 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = +3 Query: 294 FALIFLAEYSSILFIRMILVIINMGGYNLRFFFYLK 401 F L+F A ++ I + L+ I++ Y FF +LK Sbjct: 42 FLLLFFAVFNMIYSVMNFLIQIDIHSYRYCFFLFLK 77 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,170,695 Number of Sequences: 27780 Number of extensions: 74587 Number of successful extensions: 184 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 184 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 184 length of database: 12,740,198 effective HSP length: 77 effective length of database: 10,601,138 effective search space used: 1017709248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -