BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308D09f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory recept... 23 2.2 AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembran... 21 8.7 AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembran... 21 8.7 >AM292363-1|CAL23175.2| 347|Tribolium castaneum gustatory receptor candidate 42 protein. Length = 347 Score = 22.6 bits (46), Expect = 2.2 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = +3 Query: 123 RFRNCNLLLISPLFNGCYYTYKPSSSITLSIKK 221 ++RN NLLL L N ++ K + SIK+ Sbjct: 172 KYRNINLLLTEQLQNRRFFA-KKMEGLVCSIKE 203 >AF442747-1|AAL40947.1| 669|Tribolium castaneum ABC transmembrane transporter protein. Length = 669 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = -3 Query: 102 LNIFCTNIC*KKHDNKDTEYKGTTYFMSKSL 10 +N+F + ++++ Y+ + YF+SK+L Sbjct: 466 INVFSGELPVFLQEHRNGMYRPSIYFISKTL 496 >AF422804-1|AAL56571.1| 669|Tribolium castaneum ABC transmembrane transporter white protein. Length = 669 Score = 20.6 bits (41), Expect = 8.7 Identities = 8/31 (25%), Positives = 19/31 (61%) Frame = -3 Query: 102 LNIFCTNIC*KKHDNKDTEYKGTTYFMSKSL 10 +N+F + ++++ Y+ + YF+SK+L Sbjct: 466 INVFSGELPVFLQEHRNGMYRPSIYFISKTL 496 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,486 Number of Sequences: 336 Number of extensions: 2585 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -