BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308D07f (330 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC839.12 |rpc31||DNA-directed RNA polymerase III complex subun... 25 2.2 SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|... 25 3.9 >SPBC839.12 |rpc31||DNA-directed RNA polymerase III complex subunit Rpc31|Schizosaccharomyces pombe|chr 2|||Manual Length = 210 Score = 25.4 bits (53), Expect = 2.2 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = -1 Query: 51 ELRRTLGLAAAKARKQA 1 ELR+TLG A+A RK+A Sbjct: 115 ELRKTLGAASATGRKRA 131 >SPAC56F8.10 |met9|met5|methylenetetrahydrofolate reductase Met9|Schizosaccharomyces pombe|chr 1|||Manual Length = 603 Score = 24.6 bits (51), Expect = 3.9 Identities = 13/49 (26%), Positives = 25/49 (51%), Gaps = 7/49 (14%) Frame = +3 Query: 201 FYVELCIHSICRNK*TDILAT*IKKKKKNS-------RGGPVPNSPYSE 326 F V+ C+H C N T+++ +K+ + RG PV ++ ++E Sbjct: 75 FEVDTCMHLTCTNMSTEMIDAALKRAHETGCRNILALRGDPVKDTDWTE 123 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 799,485 Number of Sequences: 5004 Number of extensions: 8599 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 2,362,478 effective HSP length: 64 effective length of database: 2,042,222 effective search space used: 91899990 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -