BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308D06f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g29735.1 68417.m04234 expressed protein contains Pfam domain ... 37 0.009 At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp... 30 1.1 At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp... 30 1.1 At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp... 30 1.1 At2g30630.1 68415.m03732 expressed protein similar to H1-1flk [A... 29 2.5 At5g41620.1 68418.m05057 expressed protein weak similarity to mi... 28 4.4 At3g50300.1 68416.m05501 transferase family protein similar to a... 27 5.8 At2g30630.2 68415.m03733 expressed protein similar to H1-1flk [A... 27 5.8 At3g30842.1 68416.m03968 ABC transporter protein, putative simil... 27 7.7 >At4g29735.1 68417.m04234 expressed protein contains Pfam domain PF05251: Uncharacterised protein family (UPF0197) Length = 76 Score = 36.7 bits (81), Expect = 0.009 Identities = 24/69 (34%), Positives = 33/69 (47%) Frame = -2 Query: 346 SPINPAVFPHXXXXXXXXXXXXTAWFFVYEVTSTKASRDMFKELLLSLVAAXXXXXXXXX 167 SPI A++P TA FF+YE TS++ +R + KEL S VA+ Sbjct: 8 SPIPVALYPTLSVFTLAIGLVITAIFFIYEATSSRKNRSVGKELATSAVASVFLGFGSLF 67 Query: 166 XXLWVGIYV 140 L G+YV Sbjct: 68 LLLASGVYV 76 >At4g31200.3 68417.m04431 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 353 PDH*FNFETHFYGYFRTKHYKKQKPPRAEF 442 PD+ F F +GY+R KH+ PP F Sbjct: 156 PDYAFLFGGEGHGYYRYKHFLSMHPPGGPF 185 >At4g31200.2 68417.m04430 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 353 PDH*FNFETHFYGYFRTKHYKKQKPPRAEF 442 PD+ F F +GY+R KH+ PP F Sbjct: 156 PDYAFLFGGEGHGYYRYKHFLSMHPPGGPF 185 >At4g31200.1 68417.m04429 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein related to DAN26 [Homo sapiens] gi|1770394|emb|CAA69591 Length = 650 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 353 PDH*FNFETHFYGYFRTKHYKKQKPPRAEF 442 PD+ F F +GY+R KH+ PP F Sbjct: 156 PDYAFLFGGEGHGYYRYKHFLSMHPPGGPF 185 >At2g30630.1 68415.m03732 expressed protein similar to H1-1flk [Arabidopsis thaliana] GI:388260 Length = 531 Score = 28.7 bits (61), Expect = 2.5 Identities = 13/42 (30%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = -3 Query: 288 YSSRPGSSFTKLQVLKPQEICSKSYF-YHWWPPYFLVSEFYS 166 +S PG+ +++++ E C SYF YHW ++S+ S Sbjct: 116 FSEEPGADSLFIKLVEEFERCILSYFAYHWSHADLMISQILS 157 >At5g41620.1 68418.m05057 expressed protein weak similarity to microtubule binding protein D-CLIP-190 (GI:2773363) [Drosophila melanogaster]; weak similarity to Synaptonemal complex protein 1 (SCP-1 protein) (Swiss-Prot:Q15431) [Homo sapiens]; weak similarity to DNA double-strand break repair rad50 ATPase. (Swiss-Prot:P58301) [Pyrococcus furiosus] Length = 543 Score = 27.9 bits (59), Expect = 4.4 Identities = 16/54 (29%), Positives = 29/54 (53%) Frame = +3 Query: 150 PTHSNKNKIPKPENKAATNDKSNSLNISLEALVLVTS*TKNQAVKNIPIPSNKK 311 P +SN NK KPEN+ AT +K++ + + + S T+ + PS+++ Sbjct: 441 PENSNNNK--KPENECATTNKNDVMGEMIRTHRRLLSETREIDEASCNFPSSRR 492 >At3g50300.1 68416.m05501 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 448 Score = 27.5 bits (58), Expect = 5.8 Identities = 17/61 (27%), Positives = 29/61 (47%) Frame = +3 Query: 156 HSNKNKIPKPENKAATNDKSNSLNISLEALVLVTS*TKNQAVKNIPIPSNKKVRCGKTAG 335 H K K+ + KA ND+ S +I + +L V + V++ + ++ RCG A Sbjct: 234 HFTKEKLS--DLKAKANDEIGSSDIKISSLQAVLAHLWRSIVRHSGLNQEEESRCGVAAD 291 Query: 336 F 338 F Sbjct: 292 F 292 >At2g30630.2 68415.m03733 expressed protein similar to H1-1flk [Arabidopsis thaliana] GI:388260 Length = 552 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/39 (30%), Positives = 22/39 (56%), Gaps = 1/39 (2%) Frame = -3 Query: 288 YSSRPGSSFTKLQVLKPQEICSKSYF-YHWWPPYFLVSE 175 +S PG+ +++++ E C SYF YHW ++S+ Sbjct: 116 FSEEPGADSLFIKLVEEFERCILSYFAYHWSHADLMISQ 154 >At3g30842.1 68416.m03968 ABC transporter protein, putative similar to pleiotropic drug resistance like protein [Nicotiana tabacum] GI:20522008, ABC1 protein [Nicotiana plumbaginifolia] GI:14331118; contains Pfam profile PF00005: ABC transporter Length = 1406 Score = 27.1 bits (57), Expect = 7.7 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = +2 Query: 290 SYSEQQKG*MWKNCRVYWRRVP 355 SY Q + +WK + YWR VP Sbjct: 1131 SYLSQFQACLWKQHKSYWRNVP 1152 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,905,938 Number of Sequences: 28952 Number of extensions: 192692 Number of successful extensions: 427 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 421 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 427 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -