BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308D03f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g46510.1 68416.m05049 armadillo/beta-catenin repeat family pr... 29 2.5 At1g09340.1 68414.m01045 expressed protein 27 5.8 >At3g46510.1 68416.m05049 armadillo/beta-catenin repeat family protein / U-box domain-containing family protein contains Pfam domain, PF00514: Armadillo/beta-catenin-like repeats and Pfam, PF04564: U-box domain Length = 660 Score = 28.7 bits (61), Expect = 2.5 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +1 Query: 91 KNLFTFTQVNCSQSRYLDFFTQGSKLIVVL 180 K L + CS YL F +QGSK+ +V+ Sbjct: 63 KTLMNLKEAMCSAKDYLKFCSQGSKIYLVM 92 >At1g09340.1 68414.m01045 expressed protein Length = 378 Score = 27.5 bits (58), Expect = 5.8 Identities = 15/36 (41%), Positives = 20/36 (55%), Gaps = 4/36 (11%) Frame = +3 Query: 180 DIVLRNPKDFDLLTIKSF----NHFFVSISSNTYVL 275 +IV NPK+FD K+F HFF S+ +VL Sbjct: 298 EIVHYNPKEFDFGKKKAFPFRDQHFFASVEKAKHVL 333 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,526,094 Number of Sequences: 28952 Number of extensions: 220655 Number of successful extensions: 374 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 368 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 374 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -