BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C11f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) 220 6e-58 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 60 1e-09 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 56 1e-08 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 56 2e-08 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 56 2e-08 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 56 2e-08 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 56 2e-08 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 56 2e-08 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 54 5e-08 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 54 9e-08 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 5e-07 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 50 1e-06 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 1e-06 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 6e-06 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 8e-06 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 47 1e-05 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 42 2e-04 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.062 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.11 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 33 0.19 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 33 0.19 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 33 0.19 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 33 0.19 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.19 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 33 0.19 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 33 0.19 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 33 0.19 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 33 0.19 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 33 0.19 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 33 0.19 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 33 0.19 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 33 0.19 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.19 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 33 0.19 SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.33 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.58 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.76 SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.0 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 30 1.3 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 30 1.3 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 30 1.3 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 30 1.3 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 30 1.3 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 30 1.3 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 30 1.3 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 30 1.3 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 30 1.3 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 30 1.3 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 30 1.3 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 30 1.3 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 30 1.3 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 30 1.3 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 30 1.3 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 30 1.3 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 30 1.3 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 30 1.3 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 30 1.3 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 30 1.3 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 30 1.3 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 30 1.3 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 30 1.3 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 30 1.3 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 30 1.3 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 30 1.3 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 30 1.3 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 30 1.3 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 30 1.3 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 30 1.3 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 30 1.3 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 30 1.3 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 30 1.3 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 30 1.3 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 30 1.3 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 30 1.3 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 30 1.3 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 30 1.3 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 30 1.3 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 30 1.3 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 30 1.3 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 30 1.3 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 30 1.3 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 30 1.3 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 30 1.3 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 30 1.3 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 30 1.3 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 30 1.3 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 30 1.3 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 30 1.3 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 30 1.3 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 30 1.3 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 30 1.3 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 30 1.3 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 30 1.3 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 30 1.3 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 30 1.3 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 30 1.3 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 30 1.3 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 30 1.3 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 30 1.3 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 30 1.3 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 30 1.3 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 30 1.3 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.3 >SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 220 bits (537), Expect = 6e-58 Identities = 102/117 (87%), Positives = 112/117 (95%) Frame = -1 Query: 410 KDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHH 231 KDP+RLFEGNALLRRLVRIGVLDE + KLDYVLGL+IEDFLERRLQTQVFK GLAKSIHH Sbjct: 63 KDPRRLFEGNALLRRLVRIGVLDESRKKLDYVLGLRIEDFLERRLQTQVFKLGLAKSIHH 122 Query: 230 ARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKNLRKGQ 60 AR+LIRQRHIRVRKQ+VN+PSF+VRLDS KHIDFSL SP+GGGRPGRVKRKN++KGQ Sbjct: 123 ARVLIRQRHIRVRKQLVNVPSFVVRLDSQKHIDFSLNSPYGGGRPGRVKRKNMKKGQ 179 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 64.9 bits (151), Expect = 4e-11 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -2 Query: 520 LGNARGFXSHDVVKXRPVNCNTTHYRANW 434 LGNA+GF SHDVVK RPVNCNTTHYRANW Sbjct: 31 LGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 60.1 bits (139), Expect = 1e-09 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 520 LGNARGFXSHDVVKXRPVNCNTTHYRANW 434 LGNA F SHDVVK RPVNCNTTHYRANW Sbjct: 25 LGNASVFPSHDVVKRRPVNCNTTHYRANW 53 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 60.1 bits (139), Expect = 1e-09 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -2 Query: 520 LGNARGFXSHDVVKXRPVNCNTTHYRANW 434 LG +GF SHDVVK RPVNCNTTHYRANW Sbjct: 74 LGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 60.1 bits (139), Expect = 1e-09 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -2 Query: 520 LGNARGFXSHDVVKXRPVNCNTTHYRANW 434 LGNA F SHDVVK RPVNCNTTHYRANW Sbjct: 39 LGNASVFPSHDVVKRRPVNCNTTHYRANW 67 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 56.4 bits (130), Expect = 1e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -2 Query: 520 LGNARGFXSHDVVKXRPVNCNTTHYRAN 437 LGNARGF SHD K RPVNCNTTHYRAN Sbjct: 70 LGNARGFPSHDGEKRRPVNCNTTHYRAN 97 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 56.0 bits (129), Expect = 2e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -2 Query: 505 GFXSHDVVKXRPVNCNTTHYRANW 434 GF SHDVVK RPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 56.0 bits (129), Expect = 2e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -2 Query: 505 GFXSHDVVKXRPVNCNTTHYRANW 434 GF SHDVVK RPVNCNTTHYRANW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 56.0 bits (129), Expect = 2e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -2 Query: 505 GFXSHDVVKXRPVNCNTTHYRANW 434 GF SHDVVK RPVNCNTTHYRANW Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 56.0 bits (129), Expect = 2e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -2 Query: 505 GFXSHDVVKXRPVNCNTTHYRANW 434 GF SHDVVK RPVNCNTTHYRANW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 56.0 bits (129), Expect = 2e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -2 Query: 505 GFXSHDVVKXRPVNCNTTHYRANW 434 GF SHDVVK RPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 56.0 bits (129), Expect = 2e-08 Identities = 22/24 (91%), Positives = 22/24 (91%) Frame = -2 Query: 505 GFXSHDVVKXRPVNCNTTHYRANW 434 GF SHDVVK RPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 55.6 bits (128), Expect = 2e-08 Identities = 23/29 (79%), Positives = 24/29 (82%) Frame = -2 Query: 520 LGNARGFXSHDVVKXRPVNCNTTHYRANW 434 L +A F SHDVVK RPVNCNTTHYRANW Sbjct: 33 LAHASVFPSHDVVKRRPVNCNTTHYRANW 61 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 55.6 bits (128), Expect = 2e-08 Identities = 24/28 (85%), Positives = 24/28 (85%) Frame = -2 Query: 520 LGNARGFXSHDVVKXRPVNCNTTHYRAN 437 LGNA F SHDVVK RPVNCNTTHYRAN Sbjct: 13 LGNASVFRSHDVVKRRPVNCNTTHYRAN 40 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 54.4 bits (125), Expect = 5e-08 Identities = 26/34 (76%), Positives = 26/34 (76%) Frame = +2 Query: 419 GGARXPIRPIVSRITIHWPXFYNVVTGKTPGVTQ 520 GGA PIRPIVSRITIHWP FYN TGKT TQ Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQ 67 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 53.6 bits (123), Expect = 9e-08 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -2 Query: 502 FXSHDVVKXRPVNCNTTHYRANW 434 F SHDVVK RPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 53.6 bits (123), Expect = 9e-08 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = -2 Query: 502 FXSHDVVKXRPVNCNTTHYRANW 434 F SHDVVK RPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 51.2 bits (117), Expect = 5e-07 Identities = 21/23 (91%), Positives = 21/23 (91%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKTPGVTQ 520 SRITIHWP FYNVVTGK PGVTQ Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQ 24 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 493 HDVVKXRPVNCNTTHYRANW 434 HDVVK RPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 50.0 bits (114), Expect = 1e-06 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = -2 Query: 493 HDVVKXRPVNCNTTHYRANW 434 HDVVK RPVNCNTTHYRANW Sbjct: 2 HDVVKRRPVNCNTTHYRANW 21 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 5e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKTPGVTQ 520 SRITIHWP FYNVVTGK GVTQ Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQ 24 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 48.0 bits (109), Expect = 5e-06 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKTPGVTQ 520 SRITIHWP FYNVVTGK GVTQ Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQ 24 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 47.6 bits (108), Expect = 6e-06 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = +2 Query: 437 IRPIVSRITIHWPXFYNVVTGKT 505 +RP+VSRITIHW FYNVVTGKT Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKT 55 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 47.2 bits (107), Expect = 8e-06 Identities = 19/23 (82%), Positives = 20/23 (86%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKTPGVTQ 520 SRITIHWP FYNV+ KTPGVTQ Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQ 24 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/30 (73%), Positives = 22/30 (73%) Frame = +2 Query: 419 GGARXPIRPIVSRITIHWPXFYNVVTGKTP 508 GGA PIRPIVS ITIHWP FYN VT P Sbjct: 38 GGA--PIRPIVSHITIHWPSFYNGVTAHPP 65 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 46.8 bits (106), Expect = 1e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKTPGVTQ 520 SRITIHWP FYNVVTGKT VTQ Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQ 24 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/33 (63%), Positives = 23/33 (69%) Frame = +2 Query: 407 PSPRGGARXPIRPIVSRITIHWPXFYNVVTGKT 505 P PR + P +SRITIHWP FYNVVTGKT Sbjct: 68 PPPRWSSNSPY---MSRITIHWPSFYNVVTGKT 97 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/23 (78%), Positives = 19/23 (82%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKTPGVTQ 520 SRITIHWP FYNVV + PGVTQ Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQ 24 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/28 (67%), Positives = 20/28 (71%) Frame = +2 Query: 437 IRPIVSRITIHWPXFYNVVTGKTPGVTQ 520 IRPIVSRITIHWP FY + PGV Q Sbjct: 18 IRPIVSRITIHWPSFYKRRDWENPGVNQ 45 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKT 505 SRITIHWP FYNVVTGKT Sbjct: 2 SRITIHWPSFYNVVTGKT 19 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKT 505 SRITIHWP FYNVVTGKT Sbjct: 2 SRITIHWPSFYNVVTGKT 19 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKT 505 SRITIHWP FYNVVTGKT Sbjct: 2 SRITIHWPSFYNVVTGKT 19 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKT 505 SRITIHWP FYNVVTGKT Sbjct: 2 SRITIHWPSFYNVVTGKT 19 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/20 (85%), Positives = 17/20 (85%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKTPG 511 SRITIHWP FYNVVTGK G Sbjct: 2 SRITIHWPSFYNVVTGKNTG 21 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKT 505 SRITIHWP FYNVVTGKT Sbjct: 2 SRITIHWPSFYNVVTGKT 19 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 42.3 bits (95), Expect = 2e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +2 Query: 452 SRITIHWPXFYNVVTGKT 505 SRITIHWP FYNVVTGKT Sbjct: 2 SRITIHWPSFYNVVTGKT 19 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 40.3 bits (90), Expect = 0.001 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +2 Query: 467 HWPXFYNVVTGKTPGVTQ 520 HWP FYNVVTGKT GVTQ Sbjct: 5 HWPSFYNVVTGKTLGVTQ 22 >SB_53825| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 39.5 bits (88), Expect = 0.002 Identities = 24/84 (28%), Positives = 41/84 (48%) Frame = -1 Query: 410 KDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKSIHH 231 KDP R+ +L +L +G++ K+ L + F RRL + +A+ + Sbjct: 67 KDPYRVEATEQILEKLHNMGLISTKK-NLGQCNKVNASSFCRRRLPVVMVNLKMAQVVKD 125 Query: 230 ARILIRQRHIRVRKQVVNIPSFIV 159 A I Q H+RV +V+ P+F+V Sbjct: 126 AVKYIEQGHVRVGPEVIMDPAFLV 149 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 34.3 bits (75), Expect = 0.062 Identities = 18/36 (50%), Positives = 23/36 (63%) Frame = -2 Query: 520 LGNARGFXSHDVVKXRPVNCNTTHYRANWVPGPPSR 413 LGNAR F SHDVVK RPV + H + + PP++ Sbjct: 8 LGNARVFPSHDVVKRRPV--PSLHACRSTLEDPPNK 41 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 33.5 bits (73), Expect = 0.11 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 467 HWPXFYNVVTGKT 505 HWP FYNVVTGKT Sbjct: 62 HWPSFYNVVTGKT 74 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 33.5 bits (73), Expect = 0.11 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 467 HWPXFYNVVTGKT 505 HWP FYNVVTGKT Sbjct: 5 HWPSFYNVVTGKT 17 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 33.5 bits (73), Expect = 0.11 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +2 Query: 467 HWPXFYNVVTGKT 505 HWP FYNVVTGKT Sbjct: 57 HWPSFYNVVTGKT 69 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 255 GFSQSRRCKTTASEL 269 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 923 GFSQSRRCKTTASEL 937 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 36 GFSQSRRCKTTASEL 50 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 35 GFSQSRRCKTTASEL 49 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 410 GFSQSRRCKTTASEL 424 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 259 GFSQSRRCKTTASEL 273 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 326 GFSQSRRCKTTASEL 340 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 392 GFSQSRRCKTTASEL 406 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 84 GFSQSRRCKTTASEL 98 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 36 GFSQSRRCKTTASEL 50 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 36 GFSQSRRCKTTASEL 50 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 66 GFSQSRRCKTTASEL 80 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 302 GFSQSRRCKTTASEL 316 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 286 GFSQSRRCKTTASEL 300 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 36 GFSQSRRCKTTASEL 50 >SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) Length = 289 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 275 GFSQSRRCKTTASEL 289 >SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) Length = 314 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 300 GFSQSRRCKTTASEL 314 >SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 498 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 484 GFSQSRRCKTTASEL 498 >SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) Length = 455 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 153 GFSQSRRCKTTASEL 167 >SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) Length = 333 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 319 GFSQSRRCKTTASEL 333 >SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 169 GFSQSRRCKTTASEL 183 >SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 376 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 362 GFSQSRRCKTTASEL 376 >SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 36 GFSQSRRCKTTASEL 50 >SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 43 GFSQSRRCKTTASEL 57 >SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 29 GFSQSRRCKTTASEL 43 >SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 242 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 228 GFSQSRRCKTTASEL 242 >SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) Length = 634 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 620 GFSQSRRCKTTASEL 634 >SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2021 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 256 GFSQSRRCKTTASEL 270 >SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 65 GFSQSRRCKTTASEL 79 >SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 96 GFSQSRRCKTTASEL 110 >SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 548 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 534 GFSQSRRCKTTASEL 548 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 36 GFSQSRRCKTTASEL 50 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 117 GFSQSRRCKTTASEL 131 >SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 439 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 425 GFSQSRRCKTTASEL 439 >SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 43 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 29 GFSQSRRCKTTASEL 43 >SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) Length = 232 Score = 32.7 bits (71), Expect = 0.19 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -1 Query: 506 GFXQSRRCKTTASEL 462 GF QSRRCKTTASEL Sbjct: 218 GFSQSRRCKTTASEL 232 >SB_49287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.9 bits (69), Expect = 0.33 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +2 Query: 482 YNVVTGKTPGVTQ 520 YNVVTGKTPGVTQ Sbjct: 12 YNVVTGKTPGVTQ 24 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 506 GFXQSRRCKTTASE 465 GF QSRRCKTTASE Sbjct: 43 GFSQSRRCKTTASE 56 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 85 LAVVLQRRDWENP 97 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 31.1 bits (67), Expect = 0.58 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 506 GFXQSRRCKTTASE 465 GF QSRRCKTTASE Sbjct: 565 GFSQSRRCKTTASE 578 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 31.1 bits (67), Expect = 0.58 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = -2 Query: 520 LGNARGFXSHDVVKXRPV 467 LGNA F SHDVVK RPV Sbjct: 8 LGNASVFPSHDVVKRRPV 25 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 30.7 bits (66), Expect = 0.76 Identities = 11/13 (84%), Positives = 11/13 (84%) Frame = +2 Query: 467 HWPXFYNVVTGKT 505 HWP FYN VTGKT Sbjct: 5 HWPSFYNDVTGKT 17 >SB_41613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -1 Query: 503 FXQSRRCKTTASEL 462 F QSRRCKTTASEL Sbjct: 36 FSQSRRCKTTASEL 49 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 30.3 bits (65), Expect = 1.0 Identities = 13/24 (54%), Positives = 15/24 (62%) Frame = +2 Query: 449 VSRITIHWPXFYNVVTGKTPGVTQ 520 +SRITIHWP + PGVTQ Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQ 300 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 35 LAVVLQRRDWENP 47 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 62 LAVVLQRRDWENP 74 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 44 LAVVLQRRDWENP 56 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 36 LAVVLQRRDWENP 48 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 62 LAVVLQRRDWENP 74 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 67 LAVVLQRRDWENP 79 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 38 LAVVLQRRDWENP 50 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 58 LAVVLQRRDWENP 70 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 70 LAVVLQRRDWENP 82 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 46 LAVVLQRRDWENP 58 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 35 LAVVLQRRDWENP 47 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 25 LAVVLQRRDWENP 37 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 50 LAVVLQRRDWENP 62 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 59 LAVVLQRRDWENP 71 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 53 LAVVLQRRDWENP 65 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 69 LAVVLQRRDWENP 81 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 57 LAVVLQRRDWENP 69 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 40 LAVVLQRRDWENP 52 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 216 LAVVLQRRDWENP 228 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 111 LAVVLQRRDWENP 123 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 49 LAVVLQRRDWENP 61 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 28 LAVVLQRRDWENP 40 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 16 LAVVLQRRDWENP 28 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 47 LAVVLQRRDWENP 59 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 381 LAVVLQRRDWENP 393 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 107 LAVVLQRRDWENP 119 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 83 LAVVLQRRDWENP 95 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 39 LAVVLQRRDWENP 51 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 8 LAVVLQRRDWENP 20 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 18 LAVVLQRRDWENP 30 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 38 LAVVLQRRDWENP 50 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 103 LAVVLQRRDWENP 115 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 45 LAVVLQRRDWENP 57 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 340 LAVVLQRRDWENP 352 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 80 LAVVLQRRDWENP 92 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 50 LAVVLQRRDWENP 62 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 16 LAVVLQRRDWENP 28 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 59 LAVVLQRRDWENP 71 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 43 LAVVLQRRDWENP 55 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 134 LAVVLQRRDWENP 146 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 63 LAVVLQRRDWENP 75 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 39 LAVVLQRRDWENP 51 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 143 LAVVLQRRDWENP 155 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 833 LAVVLQRRDWENP 845 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 16 LAVVLQRRDWENP 28 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 60 LAVVLQRRDWENP 72 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 34 LAVVLQRRDWENP 46 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 73 LAVVLQRRDWENP 85 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 67 LAVVLQRRDWENP 79 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 56 LAVVLQRRDWENP 68 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 69 LAVVLQRRDWENP 81 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 256 LAVVLQRRDWENP 268 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 114 LAVVLQRRDWENP 126 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 50 LAVVLQRRDWENP 62 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 36 LAVVLQRRDWENP 48 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 37 LAVVLQRRDWENP 49 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 101 LAVVLQRRDWENP 113 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 114 LAVVLQRRDWENP 126 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 39 LAVVLQRRDWENP 51 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 20 LAVVLQRRDWENP 32 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 58 LAVVLQRRDWENP 70 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 37 LAVVLQRRDWENP 49 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 34 LAVVLQRRDWENP 46 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 11 LAVVLQRRDWENP 23 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 19 LAVVLQRRDWENP 31 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 396 LAVVLQRRDWENP 408 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 45 LAVVLQRRDWENP 57 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 54 LAVVLQRRDWENP 66 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 36 LAVVLQRRDWENP 48 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 119 LAVVLQRRDWENP 131 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 55 LAVVLQRRDWENP 67 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 65 LAVVLQRRDWENP 77 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 68 LAVVLQRRDWENP 80 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 414 LAVVLQRRDWENP 426 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 111 LAVVLQRRDWENP 123 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 67 LAVVLQRRDWENP 79 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 56 LAVVLQRRDWENP 68 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 46 LAVVLQRRDWENP 58 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 49 LAVVLQRRDWENP 61 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 161 LAVVLQRRDWENP 173 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 65 LAVVLQRRDWENP 77 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 52 LAVVLQRRDWENP 64 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 88 LAVVLQRRDWENP 100 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 37 LAVVLQRRDWENP 49 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 63 LAVVLQRRDWENP 75 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 42 LAVVLQRRDWENP 54 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 185 LAVVLQRRDWENP 197 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 34 LAVVLQRRDWENP 46 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 40 LAVVLQRRDWENP 52 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 54 LAVVLQRRDWENP 66 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 51 LAVVLQRRDWENP 63 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 34 LAVVLQRRDWENP 46 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 35 LAVVLQRRDWENP 47 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 49 LAVVLQRRDWENP 61 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 39 LAVVLQRRDWENP 51 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 132 LAVVLQRRDWENP 144 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 41 LAVVLQRRDWENP 53 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 84 LAVVLQRRDWENP 96 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 22 LAVVLQRRDWENP 34 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 153 LAVVLQRRDWENP 165 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 340 LAVVLQRRDWENP 352 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 57 LAVVLQRRDWENP 69 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 21 LAVVLQRRDWENP 33 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 109 LAVVLQRRDWENP 121 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 86 LAVVLQRRDWENP 98 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 36 LAVVLQRRDWENP 48 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 60 LAVVLQRRDWENP 72 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 294 LAVVLQRRDWENP 306 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 57 LAVVLQRRDWENP 69 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 58 LAVVLQRRDWENP 70 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 16 LAVVLQRRDWENP 28 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 36 LAVVLQRRDWENP 48 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 411 LAVVLQRRDWENP 423 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 95 LAVVLQRRDWENP 107 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 51 LAVVLQRRDWENP 63 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 43 LAVVLQRRDWENP 55 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 93 LAVVLQRRDWENP 105 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 43 LAVVLQRRDWENP 55 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 211 LAVVLQRRDWENP 223 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 43 LAVVLQRRDWENP 55 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 213 LAVVLQRRDWENP 225 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 33 LAVVLQRRDWENP 45 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 48 LAVVLQRRDWENP 60 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 38 LAVVLQRRDWENP 50 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 43 LAVVLQRRDWENP 55 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 147 LAVVLQRRDWENP 159 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 45 LAVVLQRRDWENP 57 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 35 LAVVLQRRDWENP 47 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 55 LAVVLQRRDWENP 67 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 40 LAVVLQRRDWENP 52 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 75 LAVVLQRRDWENP 87 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 195 LAVVLQRRDWENP 207 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 53 LAVVLQRRDWENP 65 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 32 LAVVLQRRDWENP 44 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 86 LAVVLQRRDWENP 98 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 29 LAVVLQRRDWENP 41 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 29.9 bits (64), Expect = 1.3 Identities = 12/13 (92%), Positives = 12/13 (92%) Frame = +1 Query: 469 LAVVLQRRDWXNP 507 LAVVLQRRDW NP Sbjct: 22 LAVVLQRRDWENP 34 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,190,849 Number of Sequences: 59808 Number of extensions: 351375 Number of successful extensions: 3703 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3625 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3699 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -