BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C09f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 23 1.4 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 1.9 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 1.9 AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. 23 2.5 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 5.8 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 5.8 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.4 bits (48), Expect = 1.4 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 1/54 (1%) Frame = -3 Query: 423 STLTLKYLDEY-SGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 265 + L ++ +D SG +I G+ + +++ +G L +S S+NT+ G Y Sbjct: 330 NALEMRLMDAIDSGYLIDEYGKKIDIYTPEGLNMLGNVIEGSSDSINTKFYGMY 383 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 1.9 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +2 Query: 371 TLITNPEYSSKYLR 412 T I N YSSKY+R Sbjct: 199 TYIVNTNYSSKYMR 212 Score = 23.0 bits (47), Expect = 1.9 Identities = 14/54 (25%), Positives = 27/54 (50%), Gaps = 1/54 (1%) Frame = -3 Query: 423 STLTLKYLDEY-SGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCY 265 + L ++ +D SG +I G+ + +++ +G L S S+NT+ G Y Sbjct: 330 NALEMRLMDAIDSGYLIDEYGKKIDIYTPEGLNMLGNVIEGNSDSINTKFYGMY 383 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 23.0 bits (47), Expect = 1.9 Identities = 16/66 (24%), Positives = 33/66 (50%) Frame = -3 Query: 396 EYSGLVIRVGGECLSLFSGDGSVTLDECGHDTSSSLNTEGKGCYIKQQQILHLLRLVTVQ 217 E+ G+ +G ++L SG+ LD GH ++ ++ +G +I +L + V+ Sbjct: 174 EFGGITQCIGAFDVTLESGERVTFLDTPGH--AAFISMRHRGAHITDIVVLVVAADDGVK 231 Query: 216 DSSLDS 199 + +L S Sbjct: 232 EQTLQS 237 >AB022907-1|BAA86908.1| 615|Apis mellifera glucose oxidase protein. Length = 615 Score = 22.6 bits (46), Expect = 2.5 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = +1 Query: 73 HDIVLVGGSTRIPKVQKLLQDFFNGKELNKSINPDE 180 +D ++VGG V L + N K L PDE Sbjct: 69 YDFIVVGGGAARAVVAGRLSEVSNWKVLLLEAGPDE 104 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 5.8 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 488 PRGAGGIPVS 459 PRG GG+P S Sbjct: 399 PRGPGGVPTS 408 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 5.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +2 Query: 326 VTLPSPLNRLRHSPP 370 +T PSP R R++PP Sbjct: 986 MTDPSPFKRGRYTPP 1000 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.315 0.137 0.384 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 150,709 Number of Sequences: 438 Number of extensions: 3046 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.5 bits)
- SilkBase 1999-2023 -