BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C07f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 24 0.71 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 24 0.71 AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory recept... 21 6.6 AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory recept... 21 6.6 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 24.2 bits (50), Expect = 0.71 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 315 YNIINYSFVSIVSFGLW*ECEYLLNKSYLIIN 410 ++++++ VS + G E + LL +SYLII+ Sbjct: 120 FDMLSHVDVSFIKAGFRLEYKQLLKRSYLIIS 151 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 24.2 bits (50), Expect = 0.71 Identities = 11/32 (34%), Positives = 21/32 (65%) Frame = +3 Query: 315 YNIINYSFVSIVSFGLW*ECEYLLNKSYLIIN 410 ++++++ VS + G E + LL +SYLII+ Sbjct: 120 FDMLSHVDVSFIKAGFRLEYKQLLKRSYLIIS 151 >AM292373-1|CAL23185.2| 360|Tribolium castaneum gustatory receptor candidate 52 protein. Length = 360 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 197 YNNIKKS*QYCVSLCIVCDFLS 262 +NNI++ YC+ + C F S Sbjct: 106 HNNIREKSHYCLFVASNCFFWS 127 >AM292353-1|CAL23165.2| 651|Tribolium castaneum gustatory receptor candidate 32 protein. Length = 651 Score = 21.0 bits (42), Expect = 6.6 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 197 YNNIKKS*QYCVSLCIVCDFLS 262 +NNI++ YC+ + C F S Sbjct: 106 HNNIREKSHYCLFVASNCFFWS 127 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 114,207 Number of Sequences: 336 Number of extensions: 2414 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -