BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C07f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55436| Best HMM Match : ig (HMM E-Value=1.2e-24) 31 0.76 SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.1 >SB_55436| Best HMM Match : ig (HMM E-Value=1.2e-24) Length = 703 Score = 30.7 bits (66), Expect = 0.76 Identities = 15/42 (35%), Positives = 21/42 (50%) Frame = -2 Query: 178 VLRGERLFGLSDNYLCN*RSVLFGISIGFYCSVDRRSVRILW 53 ++ G F L N+L +V G S+ FYC +DR I W Sbjct: 357 IVDGHHFFHLPFNFLSGGGTVPEGSSLSFYCYLDRWHGNITW 398 >SB_19782| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 728 Score = 27.5 bits (58), Expect = 7.1 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +3 Query: 249 VTSCPCRLESTETAVLQLGI*LYNIINYSFVSIVS 353 + CPC LE TETA + Y+I++ F+ ++S Sbjct: 51 ILKCPCCLEKTETANGEAN---YSILHSRFLEVLS 82 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,883,694 Number of Sequences: 59808 Number of extensions: 263273 Number of successful extensions: 509 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 509 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -