BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C04f (481 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q4XTQ6 Cluster: Putative uncharacterized protein; n=1; ... 33 3.3 UniRef50_Q4FN76 Cluster: Putative uncharacterized protein; n=2; ... 32 5.8 >UniRef50_Q4XTQ6 Cluster: Putative uncharacterized protein; n=1; Plasmodium chabaudi|Rep: Putative uncharacterized protein - Plasmodium chabaudi Length = 181 Score = 33.1 bits (72), Expect = 3.3 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 2/53 (3%) Frame = -3 Query: 188 LYNRL-INVMKHEIVVNLIFYRVFLHSESYFVRSVFLVF-S*ALKVYKNIYYL 36 +YN + IN MK +N+IFY + S S F +++FL+F S K+++ YL Sbjct: 53 VYNNVSINKMKQ---MNIIFYNILKQSPSIFYKNIFLLFISFYKKLFRYFVYL 102 >UniRef50_Q4FN76 Cluster: Putative uncharacterized protein; n=2; Candidatus Pelagibacter ubique|Rep: Putative uncharacterized protein - Pelagibacter ubique Length = 562 Score = 32.3 bits (70), Expect = 5.8 Identities = 13/42 (30%), Positives = 25/42 (59%) Frame = +1 Query: 304 FSYLSLFSCFNLNKMNVLSNCTILFIFIQKIYXIFMIKVKII 429 FS++ F + + K+N L+ + +FIF+ Y ++I KI+ Sbjct: 79 FSFIQNFILYKIFKLNYLNLSSNIFIFLMNFYLFYIILCKIL 120 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 366,304,620 Number of Sequences: 1657284 Number of extensions: 6029220 Number of successful extensions: 13603 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 13053 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13598 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27290400475 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -