Bombyx BLAST Result against rice

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS308C04f
         (481 letters)

Database: rice 
           37,544 sequences; 14,793,348 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

03_06_0224 - 32483363-32483671,32483765-32483929,32484957-32485301     27   7.9  

>03_06_0224 - 32483363-32483671,32483765-32483929,32484957-32485301
          Length = 272

 Score = 27.1 bits (57), Expect = 7.9
 Identities = 13/34 (38%), Positives = 18/34 (52%)
 Frame = -3

Query: 125 VFLHSESYFVRSVFLVFS*ALKVYKNIYYLINSC 24
           VF+ + SY V S  LVF       +N+Y+  N C
Sbjct: 156 VFVSNSSYTVTSFTLVFEFNKGTLQNLYWKANGC 189


  Database: rice
    Posted date:  Oct 4, 2007 10:57 AM
  Number of letters in database: 14,793,348
  Number of sequences in database:  37,544
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 8,740,975
Number of Sequences: 37544
Number of extensions: 128927
Number of successful extensions: 194
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 189
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 194
length of database: 14,793,348
effective HSP length: 76
effective length of database: 11,940,004
effective search space used: 991020332
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)