BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C04f (481 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z77655-3|CAB01134.1| 426|Caenorhabditis elegans Hypothetical pr... 29 1.3 U53180-7|AAA96289.1| 425|Caenorhabditis elegans Hypothetical pr... 27 5.3 >Z77655-3|CAB01134.1| 426|Caenorhabditis elegans Hypothetical protein C56A3.3 protein. Length = 426 Score = 29.5 bits (63), Expect = 1.3 Identities = 16/41 (39%), Positives = 22/41 (53%), Gaps = 2/41 (4%) Frame = +1 Query: 304 FSYLSLFSCFN-LNKMNVLSNC-TILFIFIQKIYXIFMIKV 420 F +L CFN + K V+ C T LF+ I +Y I+M V Sbjct: 171 FPQFNLRKCFNDITKEQVIEICPTSLFVTINSVYNIYMYMV 211 >U53180-7|AAA96289.1| 425|Caenorhabditis elegans Hypothetical protein D1014.2 protein. Length = 425 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -2 Query: 276 FNKLFILSLITIIHFINSKSSIVSARIRYFV 184 F+ F L+TI+HFI+ K+ + RY V Sbjct: 194 FSIAFFCLLLTIVHFIHPKTRAANKYARYVV 224 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,096,765 Number of Sequences: 27780 Number of extensions: 160429 Number of successful extensions: 334 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 334 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 882200194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -