BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C04f (481 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 6.9 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 6.9 AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. 21 9.1 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 6.9 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = +1 Query: 199 ACTYN*RFRIYKMYNCYQ*QNK*FI 273 AC + R R+Y Y CY ++ F+ Sbjct: 1056 ACFDSDRERLYDCYVCYSPNDEDFV 1080 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.0 bits (42), Expect = 6.9 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -2 Query: 426 YFHFYHKNXIDFLYENKQNR 367 YFH ++K D Y N R Sbjct: 190 YFHQFYKQQPDLNYRNSDVR 209 >AB194707-1|BAD69622.1| 247|Apis mellifera heme oxygenase protein. Length = 247 Score = 20.6 bits (41), Expect = 9.1 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +2 Query: 185 TKYLMRALTIEDLEFIKCIIVINDKINSLLN 277 TKYL+ IED E I I I LL+ Sbjct: 105 TKYLIHLKEIEDTEPILLIAYIYHLYMGLLS 135 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 110,511 Number of Sequences: 438 Number of extensions: 1891 Number of successful extensions: 3 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13051674 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -