BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C02f (454 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q7RI77 Cluster: Bromodomain, putative; n=9; cellular or... 33 2.9 UniRef50_Q8ID90 Cluster: Putative uncharacterized protein MAL13P... 32 6.6 UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyos... 32 6.6 UniRef50_Q54QX5 Cluster: Putative uncharacterized protein; n=3; ... 31 8.7 >UniRef50_Q7RI77 Cluster: Bromodomain, putative; n=9; cellular organisms|Rep: Bromodomain, putative - Plasmodium yoelii yoelii Length = 3182 Score = 33.1 bits (72), Expect = 2.9 Identities = 23/76 (30%), Positives = 37/76 (48%), Gaps = 2/76 (2%) Frame = +3 Query: 15 VTFFYRTYFKCTILLTHALQSSNLENLFKTNCYK--YLSNNDNNNKTE*KI*KSHLPNTT 188 V + Y ++ TH ++ N N+FK N YK Y + NDNN K E ++ +H+ N + Sbjct: 651 VVYSYDNNYQNKNNYTHLKENDNEHNIFK-NIYKEYYHNINDNNLKNEIELFGNHIINNS 709 Query: 189 PMPKXEIKMYLTIYTY 236 + Y+ Y Y Sbjct: 710 YIFMVLNYKYIKNYNY 725 >UniRef50_Q8ID90 Cluster: Putative uncharacterized protein MAL13P1.307; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein MAL13P1.307 - Plasmodium falciparum (isolate 3D7) Length = 137 Score = 31.9 bits (69), Expect = 6.6 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 21 FFYRTYFKCTILLTHALQSSNLENLFKTNCYKYLSNNDNN 140 FF++TY K T + Q S++ F +Y SNND+N Sbjct: 22 FFFKTYRKVTYCYKNNFQISSILLKFPPRNKRYFSNNDSN 61 >UniRef50_Q54IK3 Cluster: Ubiquitin carrier protein; n=1; Dictyostelium discoideum AX4|Rep: Ubiquitin carrier protein - Dictyostelium discoideum AX4 Length = 585 Score = 31.9 bits (69), Expect = 6.6 Identities = 19/57 (33%), Positives = 31/57 (54%) Frame = +3 Query: 48 TILLTHALQSSNLENLFKTNCYKYLSNNDNNNKTE*KI*KSHLPNTTPMPKXEIKMY 218 T + A +S+ ENL T K NN+NNN + + K L +T P+ K ++++Y Sbjct: 100 TSVPNQASDNSSGENLISTQLNKLDLNNNNNNNQQQQQQKDSLNSTEPI-KKQVELY 155 >UniRef50_Q54QX5 Cluster: Putative uncharacterized protein; n=3; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 1496 Score = 31.5 bits (68), Expect = 8.7 Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 2/54 (3%) Frame = +3 Query: 75 SSNLENLFKTNCYKYLSNNDNNNKTE*K--I*KSHLPNTTPMPKXEIKMYLTIY 230 ++N N N +SNN+NNN + + KSHL +TP+P IK TI+ Sbjct: 511 NNNNNNNNNNNNNNNISNNNNNNNSNNSRVVNKSHL--STPIPSSSIKSLHTIF 562 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 367,503,094 Number of Sequences: 1657284 Number of extensions: 6317813 Number of successful extensions: 19187 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15519 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18943 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 23511729640 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -