BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C02f (454 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC737.09c |hmt1|SPCC74.08c|ATP-binding cassette-type vacuolar ... 27 1.8 SPAC23A1.06c |cmk2|mkp2|MAPK-activated protein kinase Cmk2|Schiz... 25 7.2 SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pom... 24 9.5 >SPCC737.09c |hmt1|SPCC74.08c|ATP-binding cassette-type vacuolar membrane transporter Hmt1|Schizosaccharomyces pombe|chr 3|||Manual Length = 830 Score = 26.6 bits (56), Expect = 1.8 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 12 RVTFFYRTYFKCTILLTHALQSSNLENLFKTNCYKYLSNN 131 RVTF + T ILLT+ +Q N F T Y+ L N+ Sbjct: 513 RVTFGFNTVGDFVILLTYMIQLQQPLNFFGT-LYRSLQNS 551 >SPAC23A1.06c |cmk2|mkp2|MAPK-activated protein kinase Cmk2|Schizosaccharomyces pombe|chr 1|||Manual Length = 504 Score = 24.6 bits (51), Expect = 7.2 Identities = 12/35 (34%), Positives = 20/35 (57%) Frame = -1 Query: 409 QLYGSIFPVTYNLYSISAY*SIEFAVLVKHHNDVC 305 +L+ I TY +++ + I+ A VKH +DVC Sbjct: 148 ELFHQIVNFTYFSENLARHIIIQVAEAVKHLHDVC 182 >SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 158 Score = 24.2 bits (50), Expect = 9.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 451 EILNXYRSAEMRPCQLYGSIFPVTYNLY 368 E+++ Y+S + P S+ P+T NLY Sbjct: 69 ELVSIYQSTGLSPTSSSPSLSPMTPNLY 96 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,629,738 Number of Sequences: 5004 Number of extensions: 29094 Number of successful extensions: 67 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 67 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 67 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 168258430 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -