BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308C02f (454 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_03_0226 - 13962764-13964048,13964256-13964750,13965854-13966623 28 3.1 08_01_0906 + 8933230-8933797,8933894-8934543,8937956-8938615,893... 27 5.3 >01_03_0226 - 13962764-13964048,13964256-13964750,13965854-13966623 Length = 849 Score = 28.3 bits (60), Expect = 3.1 Identities = 14/41 (34%), Positives = 20/41 (48%) Frame = -1 Query: 427 AEMRPCQLYGSIFPVTYNLYSISAY*SIEFAVLVKHHNDVC 305 A +R C LY SIFP Y + S+S+ F ++ C Sbjct: 403 ANLRACLLYLSIFPEDYEVSSLSS--EENFVTILNDEQQTC 441 >08_01_0906 + 8933230-8933797,8933894-8934543,8937956-8938615, 8939751-8939817,8940421-8940724,8942993-8942996, 8944539-8946449 Length = 1387 Score = 27.5 bits (58), Expect = 5.3 Identities = 12/28 (42%), Positives = 19/28 (67%), Gaps = 2/28 (7%) Frame = -1 Query: 448 ILNXYRSA--EMRPCQLYGSIFPVTYNL 371 +L+ +RS ++PC LY SIFPV + + Sbjct: 833 LLSYFRSCPDSLKPCILYLSIFPVNHTI 860 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,163,179 Number of Sequences: 37544 Number of extensions: 143604 Number of successful extensions: 255 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 250 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 255 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 883560296 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -