BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308B11f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 29 0.072 DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methopren... 27 0.29 CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 27 0.29 AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific tran... 26 0.88 AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific tran... 26 0.88 AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-s... 26 0.88 AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transc... 26 0.88 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 24 2.7 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 24 2.7 AY752904-1|AAV30078.1| 84|Anopheles gambiae peroxidase 10 prot... 24 3.6 U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. 23 6.2 U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. 23 6.2 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 6.2 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 23 8.2 AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubu... 23 8.2 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 29.5 bits (63), Expect = 0.072 Identities = 19/64 (29%), Positives = 25/64 (39%), Gaps = 3/64 (4%) Frame = +3 Query: 54 KIHQAIDHFSDSPPSGRSHSFHTHHYV---SNHSDHFHHIHRGSRYLISHRPDSPTNSSP 224 K Q H S P + H H HH+ N +DHF + + + SH P Sbjct: 635 KADQTDHHQSQQPQQQQQHQHHHHHHHHHHQNPNDHFVNTNTDT-IKRSHSAQLPQREDA 693 Query: 225 RCRT 236 R RT Sbjct: 694 RSRT 697 >DQ303468-1|ABC18327.1| 1115|Anopheles gambiae putative methoprene-tolerant protein protein. Length = 1115 Score = 27.5 bits (58), Expect = 0.29 Identities = 19/77 (24%), Positives = 32/77 (41%), Gaps = 2/77 (2%) Frame = +3 Query: 108 HSFHTHHYVSNHSDHFHHIHRGSRYLISHRPDSPTNSSPRCRTIRISSARSPEPRLARV- 284 HS H HH+ +H H H S P+ N R R + R+ + R ++ Sbjct: 180 HSQHHHHHHHHHPHHSQQQHSASPRCYPMPPEHMYNMFNFNRNGREARNRAEKNRRDKLN 239 Query: 285 -SVTKLLPLIPLIRTCP 332 S+ +L ++P + P Sbjct: 240 GSIQELSAMVPHVAESP 256 Score = 25.4 bits (53), Expect = 1.2 Identities = 12/47 (25%), Positives = 18/47 (38%) Frame = +3 Query: 90 PPSGRSHSFHTHHYVSNHSDHFHHIHRGSRYLISHRPDSPTNSSPRC 230 P + S+H + + H HH H H ++SPRC Sbjct: 164 PQQQQPSSYHQQQHPGHSQHHHHHHHHH-----PHHSQQQHSASPRC 205 Score = 23.8 bits (49), Expect = 3.6 Identities = 9/32 (28%), Positives = 12/32 (37%) Frame = +3 Query: 63 QAIDHFSDSPPSGRSHSFHTHHYVSNHSDHFH 158 Q + P H H HH+ +HS H Sbjct: 168 QPSSYHQQQHPGHSQHHHHHHHHHPHHSQQQH 199 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 27.5 bits (58), Expect = 0.29 Identities = 14/45 (31%), Positives = 22/45 (48%) Frame = +3 Query: 90 PPSGRSHSFHTHHYVSNHSDHFHHIHRGSRYLISHRPDSPTNSSP 224 PPS + ++ H + +H H HH H G + P P N++P Sbjct: 1301 PPSRSEDTLNSSH-LHHHLHHGHHHHHGGEGV----PMGPANAAP 1340 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/19 (47%), Positives = 12/19 (63%) Frame = -3 Query: 180 IGNLCGYDGNGLNGSKRSG 124 +GN G GL GS+R+G Sbjct: 517 LGNFDGSQAGGLAGSERTG 535 Score = 22.6 bits (46), Expect = 8.2 Identities = 9/24 (37%), Positives = 14/24 (58%) Frame = +3 Query: 195 RPDSPTNSSPRCRTIRISSARSPE 266 +PDS T +PR T ++ + PE Sbjct: 1453 QPDSGTEQAPREATAQLPPVQPPE 1476 >AY785361-1|AAV52865.1| 960|Anopheles gambiae male-specific transcription factor FRU-MA protein. Length = 960 Score = 25.8 bits (54), Expect = 0.88 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = +3 Query: 60 HQAIDHFSDSPPSGRSHSFHTHHYVSNHSDHFHHIHR 170 HQ H S + H H ++ + H HH H+ Sbjct: 254 HQQQQHPSSHQQQSQQHPSSQHQQPTHQTHHHHHHHQ 290 Score = 23.0 bits (47), Expect = 6.2 Identities = 11/33 (33%), Positives = 14/33 (42%), Gaps = 1/33 (3%) Frame = +3 Query: 81 SDSPPSGRSHSFHTHHY-VSNHSDHFHHIHRGS 176 S SP G H HH + + H HH H + Sbjct: 698 SGSPYGGGGHHLSHHHGGAAAATGHHHHQHHAA 730 >AY785360-1|AAV52864.1| 759|Anopheles gambiae male-specific transcription factor FRU-MB protein. Length = 759 Score = 25.8 bits (54), Expect = 0.88 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = +3 Query: 60 HQAIDHFSDSPPSGRSHSFHTHHYVSNHSDHFHHIHR 170 HQ H S + H H ++ + H HH H+ Sbjct: 254 HQQQQHPSSHQQQSQQHPSSQHQQPTHQTHHHHHHHQ 290 >AY725820-1|AAU50568.1| 593|Anopheles gambiae fruitless female-specific zinc-fingerC isoform protein. Length = 593 Score = 25.8 bits (54), Expect = 0.88 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = +3 Query: 60 HQAIDHFSDSPPSGRSHSFHTHHYVSNHSDHFHHIHR 170 HQ H S + H H ++ + H HH H+ Sbjct: 206 HQQQQHPSSHQQQSQQHPSSQHQQPTHQTHHHHHHHQ 242 >AF395080-1|AAK97462.1| 537|Anopheles gambiae zinc finger transcription factor pannier protein. Length = 537 Score = 25.8 bits (54), Expect = 0.88 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 117 HTHHYVSNHSDHFHHIH 167 H+HH +H H HH H Sbjct: 496 HSHHAHPHHHHHHHHHH 512 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -2 Query: 226 RGELFVGESGRWEIKYREP 170 R EL + RWE++YR+P Sbjct: 493 RSELDRRNAHRWELQYRDP 511 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 24.2 bits (50), Expect = 2.7 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 81 SDSPPSGRSHSFHTHHYVSNHSDHFHHIH 167 S +PP S + +H V S H HH+H Sbjct: 796 SKAPPHPHS-ALSSHSPVGAGSHHLHHLH 823 >AY752904-1|AAV30078.1| 84|Anopheles gambiae peroxidase 10 protein. Length = 84 Score = 23.8 bits (49), Expect = 3.6 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +3 Query: 144 SDHFHHIHRGSRYLISHRPDS 206 +D F RG RY S+ PD+ Sbjct: 43 ADQFAKFQRGDRYFYSNGPDT 63 >U42429-1|AAB54088.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +3 Query: 90 PPSGRSHSFHTHHYVSNHSDHFHH 161 PP H H H + +H H HH Sbjct: 91 PPHHHQHPHH--HQLPHHPHHQHH 112 >U42214-1|AAB58461.1| 596|Anopheles gambiae engrailed protein. Length = 596 Score = 23.0 bits (47), Expect = 6.2 Identities = 9/24 (37%), Positives = 11/24 (45%) Frame = +3 Query: 90 PPSGRSHSFHTHHYVSNHSDHFHH 161 PP H H H + +H H HH Sbjct: 91 PPHHHQHPHH--HQLPHHPHHQHH 112 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 23.0 bits (47), Expect = 6.2 Identities = 13/45 (28%), Positives = 17/45 (37%), Gaps = 7/45 (15%) Frame = +3 Query: 60 HQAIDHFSDSPPSGRSHSFHTHHY-------VSNHSDHFHHIHRG 173 H + H PS + H HY + +H H HH H G Sbjct: 125 HPHLPHVQQHHPSVHHPAHHPLHYQPAAAAAMHHHHHHPHHHHPG 169 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 22.6 bits (46), Expect = 8.2 Identities = 25/96 (26%), Positives = 42/96 (43%), Gaps = 10/96 (10%) Frame = +3 Query: 27 TGESVPSRIKIHQAIDHFSDSPPSGRS--HSFHTHHYVSNHSDHFHHIHRGSRYLISHRP 200 T E +PSR K+ + + + R+ ++FH +NH+ + RG RY I R Sbjct: 465 TEELLPSRPKLDRLNAPYMAAMFLQRNIPYTFHLGSGETNHNFTNKKLERGKRYRIFVRA 524 Query: 201 --DSPT----NSSPRCRTIRISSARSP--EPRLARV 284 D+P SSP + + +P PR+ + Sbjct: 525 VVDTPQKHLYTSSPFSEFLALDMKEAPTTNPRIVPI 560 >AJ438610-1|CAD27473.1| 838|Anopheles gambiae putative microtubule binding protein protein. Length = 838 Score = 22.6 bits (46), Expect = 8.2 Identities = 14/37 (37%), Positives = 17/37 (45%), Gaps = 2/37 (5%) Frame = +2 Query: 74 PFFRFTPI-RTK-SFFPYTPLRFEPFRPFPSYPQRFP 178 P RF P R + F P PL+ P RP Q+ P Sbjct: 110 PTTRFAPEPRAEVKFVPSVPLKTPPVRPLLPQQQQHP 146 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 520,643 Number of Sequences: 2352 Number of extensions: 10284 Number of successful extensions: 47 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 29 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 44 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -