BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308B10f (521 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 46 3e-07 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 21 7.7 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 21 7.7 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 21 7.7 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 21 7.7 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 21 7.7 AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase pro... 21 7.7 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 45.6 bits (103), Expect = 3e-07 Identities = 30/90 (33%), Positives = 43/90 (47%), Gaps = 1/90 (1%) Frame = +3 Query: 24 SQFKPTAVLTKEGNKYKSITVNTDGP-KESVFFFESGVPFDEVVPGGFKVKTMYIVDGNT 200 S P LT+ Y T+ T P K + F+ G F+E G KVK++ +DGN Sbjct: 35 SSVSPVVELTENNGLY---TLKTTSPFKNTEIKFKLGEEFEEETVDGRKVKSVCTLDGNK 91 Query: 201 VTQTVENPNGIATFKREYSGNELKVAFKAD 290 + Q V+ T +RE+S E+K K D Sbjct: 92 LIQ-VQKGEKQTTIEREFSSTEMKAIMKVD 120 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 143 RSRPRWIQGKNHVHSRWQHRNSDCRES 223 RSR R Q + HSR++ + R S Sbjct: 218 RSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 143 RSRPRWIQGKNHVHSRWQHRNSDCRES 223 RSR R Q + HSR++ + R S Sbjct: 218 RSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 143 RSRPRWIQGKNHVHSRWQHRNSDCRES 223 RSR R Q + HSR++ + R S Sbjct: 218 RSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 143 RSRPRWIQGKNHVHSRWQHRNSDCRES 223 RSR R Q + HSR++ + R S Sbjct: 218 RSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 21.0 bits (42), Expect = 7.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = +2 Query: 143 RSRPRWIQGKNHVHSRWQHRNSDCRES 223 RSR R Q + HSR++ + R S Sbjct: 218 RSRSRSFQRTSSCHSRYEDSRHEDRNS 244 >AB253415-1|BAE86926.1| 588|Apis mellifera alpha-glucosidase protein. Length = 588 Score = 21.0 bits (42), Expect = 7.7 Identities = 9/34 (26%), Positives = 17/34 (50%) Frame = -1 Query: 212 SLSYGVAIDYVHGFYLESTWDDFVERHTGLKKKN 111 SL++ + D + L W DFV+ + K++ Sbjct: 259 SLNHTLTKDQPETYELVKEWRDFVDNYAEENKRD 292 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,799 Number of Sequences: 438 Number of extensions: 3234 Number of successful extensions: 9 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14600229 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -