BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308B06f (392 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_1294 - 36076524-36076554,36076821-36076891,36077221-360772... 101 2e-22 05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 101 3e-22 07_03_0078 - 13147741-13148913 30 0.58 09_01_0024 + 438288-438542,439020-439069,440096-440351 29 1.8 04_04_1144 + 31222556-31222633,31223238-31227665,31227724-312277... 28 2.3 03_06_0682 - 35516081-35518303 28 3.1 11_02_0038 - 7631462-7634428,7635975-7636250 27 4.1 12_01_0268 - 1941515-1941534,1941868-1942057,1942155-1942322,194... 26 9.4 04_01_0016 - 249026-249049,250193-250606 26 9.4 >01_06_1294 - 36076524-36076554,36076821-36076891,36077221-36077275, 36077363-36077562,36078614-36078715 Length = 152 Score = 101 bits (242), Expect = 2e-22 Identities = 55/100 (55%), Positives = 66/100 (66%) Frame = +3 Query: 15 VGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAM 194 VG+ KGH TK + + RP+ KG TK FVR L+REVVG A YEKR Sbjct: 12 VGINKGHVVTK----------RELPPRPSDRKGKSTKRVNFVRGLIREVVGFAPYEKRIT 61 Query: 195 ELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 314 ELLKV KDKRALK KR+LGTH RAK+KREE++ V+ +MR Sbjct: 62 ELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVIRKMR 101 >05_05_0108 + 22451440-22451541,22452228-22452427,22452979-22453018 Length = 113 Score = 101 bits (241), Expect = 3e-22 Identities = 55/100 (55%), Positives = 66/100 (66%) Frame = +3 Query: 15 VGLRKGHKTTKISAGRKGITDKAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAM 194 VG+ KGH TK + + RP+ KG TK FVR+L+REV G A YEKR Sbjct: 12 VGINKGHVVTK----------RELPPRPSDRKGKSTKRVTFVRNLIREVAGFAPYEKRIT 61 Query: 195 ELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNVLAQMR 314 ELLKV KDKRALK KR+LGTH RAK+KREE++ VL +MR Sbjct: 62 ELLKVGKDKRALKVAKRKLGTHKRAKKKREEMAGVLRKMR 101 >07_03_0078 - 13147741-13148913 Length = 390 Score = 30.3 bits (65), Expect = 0.58 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = -2 Query: 100 AGLILMALSVIPLRPADILVVLWPF 26 AGL+ AL VIP P + +V WPF Sbjct: 71 AGLLYFALVVIPALPGVLRLVAWPF 95 >09_01_0024 + 438288-438542,439020-439069,440096-440351 Length = 186 Score = 28.7 bits (61), Expect = 1.8 Identities = 14/42 (33%), Positives = 26/42 (61%) Frame = +3 Query: 171 AQYEKRAMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSN 296 A++E R E LK ++++ A K LKR+ + ++KR + +N Sbjct: 122 AEFELRREERLKEAEERTAKKRLKRQKKKQRKKEKKRSKTNN 163 >04_04_1144 + 31222556-31222633,31223238-31227665,31227724-31227789, 31227790-31228014,31228097-31228255,31228393-31228551, 31228855-31229013,31229371-31229490,31229604-31229825 Length = 1871 Score = 28.3 bits (60), Expect = 2.3 Identities = 20/76 (26%), Positives = 41/76 (53%) Frame = +3 Query: 78 KAIRIRPARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLKVSKDKRALKFLKRRLGT 257 +A + + A L+ + S+ ++LV E +G EK+ +ELL + +++ ++LK + Sbjct: 639 EAYQTKAASLEAVMESASEKEKELV-ESLGQITEEKKKLELLVLEYEEKTEEYLKEKQSL 697 Query: 258 HIRAKRKREELSNVLA 305 +R + + S VLA Sbjct: 698 E---ERLQSQESKVLA 710 >03_06_0682 - 35516081-35518303 Length = 740 Score = 27.9 bits (59), Expect = 3.1 Identities = 16/73 (21%), Positives = 35/73 (47%), Gaps = 4/73 (5%) Frame = +3 Query: 96 PARLKGLQTKHSKFVRDLVREVVGHAQYEKRAMELLK----VSKDKRALKFLKRRLGTHI 263 P + L+ + F+++++ +++ EKR ELL+ ++K LG+ + Sbjct: 324 PKEVHHLKDLNENFIKEIIERSAFNSEEEKRQSELLEMVGDIAKKCSGSPLAATALGSTL 383 Query: 264 RAKRKREELSNVL 302 R K ++E +L Sbjct: 384 RTKTTKKEWEAIL 396 >11_02_0038 - 7631462-7634428,7635975-7636250 Length = 1080 Score = 27.5 bits (58), Expect = 4.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 216 DKRALKFLKRRLGTHIRAKRKREELSNV 299 DK+ LKFL R TH + E+++N+ Sbjct: 791 DKKHLKFLNLRCTTHTKESYTMEDITNI 818 >12_01_0268 - 1941515-1941534,1941868-1942057,1942155-1942322, 1943425-1943568,1944284-1944443,1944512-1944621, 1944900-1945019,1945649-1945766,1946610-1946729, 1947228-1947285,1947590-1947723,1949332-1949414, 1949544-1949786,1949851-1949976,1950075-1951562 Length = 1093 Score = 26.2 bits (55), Expect = 9.4 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = +3 Query: 216 DKRALKFLKRRLGTHIRAKRKREELSNVL 302 DK L K +G + +R+RE+LSN+L Sbjct: 498 DKVLLNVRKLYIGLSMSKRRQREQLSNIL 526 >04_01_0016 - 249026-249049,250193-250606 Length = 145 Score = 26.2 bits (55), Expect = 9.4 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 359 IYHLMVMVMSLGGCLPHLSEHVAKFFTLPLGADVC 255 I HL VM ++ GC+P V K LPL C Sbjct: 53 ITHL-VMCTTVSGCMPGADFEVVKLLGLPLTTKRC 86 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,121,562 Number of Sequences: 37544 Number of extensions: 163463 Number of successful extensions: 414 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 409 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 414 length of database: 14,793,348 effective HSP length: 74 effective length of database: 12,015,092 effective search space used: 672845152 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -