BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308B05f (521 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. 23 1.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 5.0 AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase ... 21 5.0 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 21 5.0 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 21 5.0 >AY884065-1|AAX84206.1| 697|Tribolium castaneum laccase 1 protein. Length = 697 Score = 23.0 bits (47), Expect = 1.6 Identities = 17/59 (28%), Positives = 26/59 (44%), Gaps = 6/59 (10%) Frame = -3 Query: 426 YQRDVSLDFSHVSLPLYLSALSQSLHNII------ITPSLSDLFHFLHSFDCFSPQFAI 268 +Q VS DF ++ P+Y HN+ +TP L+ + L SF S + I Sbjct: 426 FQYYVSYDFYKMNHPVYHKDPHYGFHNVTNTTLQNLTPQLNYISMKLQSFPLLSQRHQI 484 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 5.0 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = -3 Query: 279 QFAIVFQGHISSLFKLKGWV 220 ++ +F +S +FK +GWV Sbjct: 313 EYLNLFLEELSEIFKPRGWV 332 >AY362543-1|AAQ63455.1| 677|Tribolium castaneum chitin synthase protein. Length = 677 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 481 EVEPETIEVVDA 516 E+EPETIE DA Sbjct: 287 ELEPETIESQDA 298 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 481 EVEPETIEVVDA 516 E+EPETIE DA Sbjct: 520 ELEPETIESQDA 531 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 21.4 bits (43), Expect = 5.0 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +1 Query: 481 EVEPETIEVVDA 516 E+EPETIE DA Sbjct: 520 ELEPETIESQDA 531 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 116,418 Number of Sequences: 336 Number of extensions: 2185 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12573240 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -