BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308B04f (521 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_02_0148 - 7085892-7086011,7086681-7087004,7088258-7088419,708... 28 5.2 03_05_0714 - 27076881-27077218,27077332-27077482,27077768-270779... 27 6.9 >05_02_0148 - 7085892-7086011,7086681-7087004,7088258-7088419, 7088866-7089066,7089148-7089332,7089459-7089588 Length = 373 Score = 27.9 bits (59), Expect = 5.2 Identities = 12/48 (25%), Positives = 26/48 (54%), Gaps = 4/48 (8%) Frame = -3 Query: 213 ITNILKHIIF----VITISISLSWRTIRMSYVSKAIIIR*FCFVAKLF 82 + ++K + F ++ +++SL W ++ ++K II CF+ LF Sbjct: 75 VPELIKFVFFANLSIVGMNVSLMWNSVGFYQIAKLCIIPVLCFLEILF 122 >03_05_0714 - 27076881-27077218,27077332-27077482,27077768-27077903, 27078309-27078457,27079141-27079267,27080033-27080172, 27080264-27080329,27080760-27080901,27081021-27081115, 27081640-27082140 Length = 614 Score = 27.5 bits (58), Expect = 6.9 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +2 Query: 290 IISRIRWFIL*GLH*NLFKKLRQFMKLAIQQKTLFLIILK 409 I+SRI W I +H L +K+ +F+ + + + I+++ Sbjct: 338 ILSRIMWIIGNTVHATLLQKILEFLSALVDDQDVITILIE 377 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,972,247 Number of Sequences: 37544 Number of extensions: 168246 Number of successful extensions: 258 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 258 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1142636160 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -