BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308B04f (521 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_22259| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.1 SB_33576| Best HMM Match : Pentaxin (HMM E-Value=1.3e-06) 28 5.4 SB_33575| Best HMM Match : PAN (HMM E-Value=0.00074) 27 9.4 >SB_22259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 625 Score = 28.7 bits (61), Expect = 3.1 Identities = 20/65 (30%), Positives = 39/65 (60%), Gaps = 5/65 (7%) Frame = +2 Query: 281 STHIISRIR-WF----IL*GLH*NLFKKLRQFMKLAIQQKTLFLIILKVTQTYINAPSQR 445 +THII+ + WF G + ++ ++ R +++ I+Q+ +II K+TQ YI AP+ + Sbjct: 363 ATHIIANSKFWFSNYYYNEGFYSSMQRRGRDWLQRTIRQQH-DVIISKITQLYIRAPTGK 421 Query: 446 SQRSA 460 + + A Sbjct: 422 ATQCA 426 >SB_33576| Best HMM Match : Pentaxin (HMM E-Value=1.3e-06) Length = 799 Score = 27.9 bits (59), Expect = 5.4 Identities = 18/46 (39%), Positives = 24/46 (52%) Frame = -2 Query: 508 GSRISDLTRNHVTVTTCASLRSLTWRINICLCYFQYN*KKRFLLNR 371 GS D+T NHVTVT L+ LT + C + QY K L+ + Sbjct: 30 GSYKRDVTYNHVTVT---QLKELTAMSSRCEQFIQYECKGSALVQK 72 >SB_33575| Best HMM Match : PAN (HMM E-Value=0.00074) Length = 328 Score = 27.1 bits (57), Expect = 9.4 Identities = 17/39 (43%), Positives = 21/39 (53%) Frame = -2 Query: 508 GSRISDLTRNHVTVTTCASLRSLTWRINICLCYFQYN*K 392 GS D+T NHVTVT L+ LT + C + QY K Sbjct: 194 GSYKRDVTYNHVTVT---QLKELTAMSSRCEQFIQYECK 229 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,511,057 Number of Sequences: 59808 Number of extensions: 218131 Number of successful extensions: 322 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 273 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 322 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1172759136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -