BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308B04f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein ... 23 6.2 AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. 23 8.2 AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. 23 8.2 >AY263175-1|AAP78790.1| 814|Anopheles gambiae TmcA-like protein protein. Length = 814 Score = 23.0 bits (47), Expect = 6.2 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 3/44 (6%) Frame = +3 Query: 6 IRHEA*YRIIKSNTFIFISIGMCYNEIILPQSKTIV*L---WLC 128 + HE +R +SN F F + +LP S IV L W C Sbjct: 587 VPHEVVFRASRSNNFYFALLLTMLFLCVLPVSYAIVFLEPSWHC 630 >AY341224-1|AAR13788.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 286 AHYKPYTLVYIIRAALKSF 342 AH K +TLVYI+ + SF Sbjct: 137 AHAKNHTLVYILVSVAVSF 155 >AY341223-1|AAR13787.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 286 AHYKPYTLVYIIRAALKSF 342 AH K +TLVYI+ + SF Sbjct: 137 AHAKNHTLVYILVSVAVSF 155 >AY341222-1|AAR13786.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 286 AHYKPYTLVYIIRAALKSF 342 AH K +TLVYI+ + SF Sbjct: 137 AHAKNHTLVYILVSVAVSF 155 >AY341221-1|AAR13785.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 286 AHYKPYTLVYIIRAALKSF 342 AH K +TLVYI+ + SF Sbjct: 137 AHAKNHTLVYILVSVAVSF 155 >AY341220-1|AAR13784.1| 287|Anopheles gambiae TOLL9 protein. Length = 287 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 286 AHYKPYTLVYIIRAALKSF 342 AH K +TLVYI+ + SF Sbjct: 137 AHAKNHTLVYILVSVAVSF 155 >AF444782-1|AAL37903.1| 576|Anopheles gambiae Toll9 protein. Length = 576 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = +1 Query: 286 AHYKPYTLVYIIRAALKSF 342 AH K +TLVYI+ + SF Sbjct: 364 AHAKNHTLVYILVSVAVSF 382 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 469,644 Number of Sequences: 2352 Number of extensions: 8405 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -