BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308B02f (521 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g21800.2 68417.m03154 ATP-binding family protein contains Pfa... 28 4.4 At4g21800.1 68417.m03153 ATP-binding family protein contains Pfa... 28 4.4 At4g18010.2 68417.m02680 inositol polyphosphate 5-phosphatase II... 27 5.8 At4g18010.1 68417.m02679 inositol polyphosphate 5-phosphatase II... 27 5.8 At2g36490.1 68415.m04479 HhH-GPD base excision DNA repair family... 27 5.8 At4g14980.1 68417.m02302 DC1 domain-containing protein contains ... 27 7.7 >At4g21800.2 68417.m03154 ATP-binding family protein contains Pfam domain, PF03029: Conserved hypothetical ATP binding protein Length = 379 Score = 27.9 bits (59), Expect = 4.4 Identities = 17/83 (20%), Positives = 34/83 (40%) Frame = -2 Query: 424 VILDLNVVVLRTTALIRVVEA*ASLAVYFAIRLPGFVEVCAHHASGVCLVGTVLDAVTHG 245 ++ LN+ + ++ V+E A Y + PG +E+ ASG + Sbjct: 113 ILTSLNLFATKFDEVVSVIEKRADQLDYVLVDTPGQIEIFTWSASGAIITEAFASTFPTV 172 Query: 244 VSVFVDFADTSCAAVDFQARVFH 176 V+ VD S + + F + + + Sbjct: 173 VTYVVD-TPRSSSPITFMSNMLY 194 >At4g21800.1 68417.m03153 ATP-binding family protein contains Pfam domain, PF03029: Conserved hypothetical ATP binding protein Length = 379 Score = 27.9 bits (59), Expect = 4.4 Identities = 17/83 (20%), Positives = 34/83 (40%) Frame = -2 Query: 424 VILDLNVVVLRTTALIRVVEA*ASLAVYFAIRLPGFVEVCAHHASGVCLVGTVLDAVTHG 245 ++ LN+ + ++ V+E A Y + PG +E+ ASG + Sbjct: 113 ILTSLNLFATKFDEVVSVIEKRADQLDYVLVDTPGQIEIFTWSASGAIITEAFASTFPTV 172 Query: 244 VSVFVDFADTSCAAVDFQARVFH 176 V+ VD S + + F + + + Sbjct: 173 VTYVVD-TPRSSSPITFMSNMLY 194 >At4g18010.2 68417.m02680 inositol polyphosphate 5-phosphatase II (IP5PII) nearly identical to inositol polyphosphate 5-phosphatase II [Arabidopsis thaliana] GI:10444263 isoform contains an AT-acceptor splice site at intron 6 Length = 613 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 407 RGGIADHGTDQSCRGISIAGGILR 336 RG ADHG + S G+S+ GG R Sbjct: 68 RGSEADHGNNISDGGVSVRGGYQR 91 >At4g18010.1 68417.m02679 inositol polyphosphate 5-phosphatase II (IP5PII) nearly identical to inositol polyphosphate 5-phosphatase II [Arabidopsis thaliana] GI:10444263 isoform contains an AT-acceptor splice site at intron 6 Length = 646 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = -1 Query: 407 RGGIADHGTDQSCRGISIAGGILR 336 RG ADHG + S G+S+ GG R Sbjct: 68 RGSEADHGNNISDGGVSVRGGYQR 91 >At2g36490.1 68415.m04479 HhH-GPD base excision DNA repair family protein (ROS1) similar to DEMETER protein [Arabidopsis thaliana] GI:21743571; contains Pfam profile PF00730: HhH-GPD superfamily base excision DNA repair protein Length = 1393 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/27 (44%), Positives = 14/27 (51%) Frame = +3 Query: 297 WCAQTSTKPGNRIAKYTASDAYASTTL 377 W QT KP + I YT D Y S+ L Sbjct: 16 WIPQTPMKPFSPICPYTVEDQYHSSQL 42 >At4g14980.1 68417.m02302 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 470 Score = 27.1 bits (57), Expect = 7.7 Identities = 18/63 (28%), Positives = 24/63 (38%), Gaps = 3/63 (4%) Frame = +2 Query: 269 CPYETDSRRMVCTNFNETWQSDCEVYRQRCLCLDNSDQCRGPQYHHVQIEYY---GTCRE 439 C E D VC N DC R +C++ D +H Q E + G CR+ Sbjct: 71 CGVEGDRNPYVCLQCNLMVHKDCIENLPRVICINRHDHRIFHTFHLGQREEHWECGVCRK 130 Query: 440 MPD 448 D Sbjct: 131 TVD 133 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,081,809 Number of Sequences: 28952 Number of extensions: 215987 Number of successful extensions: 714 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 714 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 957410176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -