BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308B01f (521 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe... 92 4e-20 SPBC29A3.10c |atp14||F1-ATPase subunit H |Schizosaccharomyces po... 25 5.2 SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit Smc6|Schizosac... 25 9.0 >SPMIT.04 |cox3||cytochrome c oxidase 3|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 273 Score = 92.3 bits (219), Expect = 4e-20 Identities = 52/131 (39%), Positives = 67/131 (51%), Gaps = 2/131 (1%) Frame = +3 Query: 135 RDISREGTYQGKHTILVNKGLR*GXXXXXXXXXXXXXXXXXXXXHRRLSPNIEIGRI*PP 314 RD+S E G HT V KGL+ G H LSP E+G + PP Sbjct: 69 RDMSTEANIHGAHTKAVTKGLKIGFMLFLISETFLFASIFWAFFHSSLSPTFELGAVWPP 128 Query: 315 SRITP--FNPFQIPLLNTIILIRSGVTVT*AHHSLIENNFSQTKQRLFLTILLGFYFTIL 488 I +P ++PLLNT+IL+ SG ++T AH+SLI N + L++TI L F F Sbjct: 129 VGIADKTIDPLEVPLLNTVILLTSGASLTYAHYSLIARNRENALKGLYMTIALSFLFLGG 188 Query: 489 QAYEYIEASFT 521 QAYEY A FT Sbjct: 189 QAYEYWNAPFT 199 >SPBC29A3.10c |atp14||F1-ATPase subunit H |Schizosaccharomyces pombe|chr 2|||Manual Length = 103 Score = 25.4 bits (53), Expect = 5.2 Identities = 8/29 (27%), Positives = 19/29 (65%) Frame = +3 Query: 414 IENNFSQTKQRLFLTILLGFYFTILQAYE 500 + ++S T RL++ ++ G Y + L++Y+ Sbjct: 8 LSRSYSTTSPRLYVDVVQGLYISSLKSYK 36 >SPCC5E4.06 |smc6|rad18|Smc5-6 complex SMC subunit Smc6|Schizosaccharomyces pombe|chr 3|||Manual Length = 1140 Score = 24.6 bits (51), Expect = 9.0 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 277 YPQILKLEEYDPPQELHHLIH 339 YP +LK+ ++D + LH LI+ Sbjct: 622 YPTVLKIIKFDDDEVLHTLIN 642 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,452,582 Number of Sequences: 5004 Number of extensions: 22220 Number of successful extensions: 48 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 45 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 46 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 212331630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -