BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308A12f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 26 0.88 AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. 24 2.7 AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. 24 2.7 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 23 8.2 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 25.8 bits (54), Expect = 0.88 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = +2 Query: 212 PTDYPFKPP-KVAFTTRI 262 PTDY +KPP K+ TT++ Sbjct: 390 PTDYSYKPPAKITVTTQM 407 >AY017417-1|AAG54081.1| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 24.2 bits (50), Expect = 2.7 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -2 Query: 232 FERVVCREMYGKEENSSLIRTVNWAHNCGLPMEQIF 125 F ++VC YG+EE+ + +N+ L EQI+ Sbjct: 54 FGQIVCSFRYGREEDE--VMGLNFQKELCLASEQIY 87 >AJ304409-1|CAC39103.2| 383|Anopheles gambiae arrestin protein. Length = 383 Score = 24.2 bits (50), Expect = 2.7 Identities = 12/36 (33%), Positives = 20/36 (55%) Frame = -2 Query: 232 FERVVCREMYGKEENSSLIRTVNWAHNCGLPMEQIF 125 F ++VC YG+EE+ + +N+ L EQI+ Sbjct: 54 FGQIVCSFRYGREEDE--VMGLNFQKELCLASEQIY 87 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 22.6 bits (46), Expect = 8.2 Identities = 7/19 (36%), Positives = 12/19 (63%) Frame = +1 Query: 175 LSRRSFLPYHTFPYRLPFQ 231 ++ + +PYH PY P+Q Sbjct: 341 MASMNIVPYHMSPYGHPYQ 359 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 647,992 Number of Sequences: 2352 Number of extensions: 15821 Number of successful extensions: 32 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -