Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= ovS308A10f
         (521 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AL358975-4|CAC22598.1|   91|Homo sapiens transducin-like enhance...    31   3.2  

>AL358975-4|CAC22598.1|   91|Homo sapiens transducin-like enhancer
           of split 4 (E(sp1) homolog, Drosophila) protein.
          Length = 91

 Score = 30.7 bits (66), Expect = 3.2
 Identities = 10/44 (22%), Positives = 23/44 (52%)
 Frame = +2

Query: 335 CHQIRLGYHHIRPDYHHIRLDCHHIRLDCHHIRLDYHHIRPDCH 466
           C +I+  +  ++  YH ++L+C  +  +   ++  Y  +R  CH
Sbjct: 32  CDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMVRKPCH 75


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 46,420,972
Number of Sequences: 237096
Number of extensions: 749257
Number of successful extensions: 1394
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1252
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1391
length of database: 76,859,062
effective HSP length: 85
effective length of database: 56,705,902
effective search space used: 4990119376
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)