BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ovS308A08f (521 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adh... 24 2.7 AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CY... 23 6.2 M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles ... 23 8.2 >AJ439060-11|CAD27762.1| 1881|Anopheles gambiae putative cell-adhesion protein protein. Length = 1881 Score = 24.2 bits (50), Expect = 2.7 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 98 TTIITDVQTRRPGYRLDGFSLD 33 T I+TDV P +R DG+ + Sbjct: 385 TVIVTDVNDEIPRFRSDGYECE 406 >AY176049-1|AAO19580.1| 515|Anopheles gambiae cytochrome P450 CYP12F3 protein. Length = 515 Score = 23.0 bits (47), Expect = 6.2 Identities = 11/50 (22%), Positives = 20/50 (40%) Frame = +1 Query: 31 WSKLKPSRRYPGRRVWTSVIIVVLINTYDRLQI*HSKVNYKDFYGC*FKV 180 W+ KP + PG +W YD L + + + YG +++ Sbjct: 34 WASAKPYKSIPGPTLWQLFRGFSKGGCYDGLNLIELHIRLRQEYGDIYRI 83 >M93689-1|AAA29368.1| 442|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 442 Score = 22.6 bits (46), Expect = 8.2 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +1 Query: 193 FSSATGASHYSTSGGCRSASPIHT 264 F + SH S+S C SA+P T Sbjct: 346 FDPSALTSHRSSSANCSSAAPKST 369 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 603,468 Number of Sequences: 2352 Number of extensions: 12750 Number of successful extensions: 21 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 47783067 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -